DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and PCD1

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_013252.1 Gene:PCD1 / 850844 SGDID:S000004141 Length:340 Species:Saccharomyces cerevisiae


Alignment Length:162 Identity:35/162 - (21%)
Similarity:50/162 - (30%) Gaps:80/162 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 KASSNKLPEKSKIPSDI------LDDLASRFIINVPDMELNNLIRMCFQIELAHWFYLDFFCAPE 255
            |....|..:|.|:|.||      |:...:..:.:||   ||:|:     |.|          .||
Yeast   142 KDKLEKHEDKYKVPLDIRKFFGKLNPGETSSLFSVP---LNDLV-----IHL----------LPE 188

  Fly   256 SGEDGETPKCVQRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAI--LV 318
            :.||               :|.:..:.|                  |.|.|||:   :|.|  |:
Yeast   189 ADED---------------VKSYQAEYF------------------ERKEYKLN---WGGIKWLI 217

  Fly   319 SEDHNHCLLVQSYFARNSWGFPKGKINENEDP 350
            ...|.|.                  .|.||.|
Yeast   218 MHYHFHV------------------ANNNEMP 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 18/100 (18%)
Dcp2p 310..459 CDD:239644 9/43 (21%)
PCD1NP_013252.1 CoAse 38..265 CDD:239518 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.