DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and NUDT18

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_172939.1 Gene:NUDT18 / 838051 AraportID:AT1G14860 Length:176 Species:Arabidopsis thaliana


Alignment Length:135 Identity:30/135 - (22%)
Similarity:49/135 - (36%) Gaps:31/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 YKLSVPTYGAI-------LVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETG 363
            |:|.:.:.|.|       ::|....|.|:           ||||....:|.....|:||..||.|
plant    28 YRLKISSDGTISDEFEVLVISSQKGHALM-----------FPKGGWELDESVEEAASRESLEEAG 81

  Fly   364 F--DITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQFAP----RTRNEIK-------CCDWFRI 415
            .  ::...:...|::.......|........:..:.:..|    |.|..:|       |.||:..
plant    82 VVGNVERQLGKWDFLSKSKGTFYEGFMFPMLVKEELELWPEQHLRQRIWMKVDEARDACRDWWMK 146

  Fly   416 DALPV 420
            :||.|
plant   147 EALDV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265 30/135 (22%)
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 28/131 (21%)
NUDT18NP_172939.1 NUDIX_DIPP2_like_Nudt4 21..152 CDD:467551 30/135 (22%)

Return to query results.
Submit another query.