DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and NUDT12

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_563919.1 Gene:NUDT12 / 837845 AraportID:AT1G12880 Length:203 Species:Arabidopsis thaliana


Alignment Length:176 Identity:33/176 - (18%)
Similarity:55/176 - (31%) Gaps:79/176 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 KLSVPTYGAILVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLID 371
            ||.|     ::||..:.|.|:           ||||...::|.....|:||..||.|..      
plant    47 KLEV-----LMVSSPNRHDLV-----------FPKGGWEDDETVLEAASREAIEEAGVK------ 89

  Fly   372 ANDYIEAFINYQYTRLYVVRNIPMDT---------------------QFAPRTRNEIKCCDWFRI 415
                            .::|.:|:..                     .||.:...|::  ||   
plant    90 ----------------GILRELPLGVWEFRSKSSTVEDECLGGCKGYMFALKVTEELE--DW--- 133

  Fly   416 DALPVNKN---------DAISKAK---LGKTSNSFFMIMPFVKRLK 449
               |..||         :|:...:   :.:....|..:|...:||:
plant   134 ---PERKNRERRWLTVKEALELCRYEWMQRALEEFLRVMEDERRLR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 31/173 (18%)
NUDT12NP_563919.1 NUDIX_DIPP2_like_Nudt4 21..165 CDD:467551 29/163 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.