DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and DCP2

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001190304.1 Gene:DCP2 / 831201 AraportID:AT5G13570 Length:386 Species:Arabidopsis thaliana


Alignment Length:385 Identity:113/385 - (29%)
Similarity:171/385 - (44%) Gaps:80/385 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 ASTTKASSNKLPEKSKIPSDILDDLASRFIINVPDMELNNLIRMCFQIELAHWFYLDFFCAPESG 257
            :|::|...|.||.|     ::||||.|||::|||:.:..:..|:.|.:|.|:|:|          
plant     8 SSSSKNIGNCLPSK-----ELLDDLCSRFVLNVPEEDQQSFERILFLVEYAYWYY---------- 57

  Fly   258 EDGETPKCVQRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDH 322
            ||.....  ..||.|:.:|:|...||.....|..:...:|.|..::.:||..||..|||::.|.:
plant    58 EDNAVEN--DPKLKSLSLKEFTSLLFNSCDVLRPYVTHIDDIFKDFTSYKCRVPVTGAIILDETY 120

  Fly   323 NHCLLVQSYFARNSWGFPKGKINENEDPAHCATRE-------------VYEETGFDITDLIDAND 374
            ..||||:.: ..:||.||:||.:::|:...||.||             |.||||||::.|:...:
plant   121 ERCLLVKGW-KGSSWSFPRGKKSKDEEDHACAIRELSSAILLVNVAFQVLEETGFDVSKLLKREE 184

  Fly   375 YIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFF 439
            |||.....|..|||:|..:..||.|||.|:.||....|.|:|.|....|:.|:.   |.:....:
plant   185 YIEFVFRQQRVRLYIVAGVTEDTVFAPLTKKEISEITWHRLDHLQPASNEVITH---GVSGLKLY 246

  Fly   440 MIMPFVKRLKKWVNDRKAGIEPRRRK---------------------FSGQQSPKAASPTNMNGN 483
            |:.||:..||.|:....:.:..|..|                     ...|........|.|..|
plant   247 MVAPFLSSLKSWILKHPSPVARRPNKPLKALCVWNARTSVGGNGTATVESQNRKSELRTTTMESN 311

  Fly   484 CKKDVTGVRNESQR---QRHKSMGDLDGVKLNNLNGKGTVGTGAGSAASASATAAINSMN 540
            .:|.      |.:|   :.|.:..:|         .|||:       .|.:.||.:.|.|
plant   312 SRKP------ELKRTTMESHSTKPEL---------RKGTM-------ESHNTTATVESHN 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 28/94 (30%)
Dcp2p 310..459 CDD:239644 58/161 (36%)
DCP2NP_001190304.1 DCP2 22..105 CDD:282833 25/82 (30%)
Dcp2p 108..265 CDD:239644 60/169 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 97 1.000 Domainoid score I2447
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H50723
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002974
OrthoInspector 1 1.000 - - oto4153
orthoMCL 1 0.900 - - OOG6_102623
Panther 1 1.100 - - LDO PTHR23114
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2325
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.