DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and NUDX13

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_189303.1 Gene:NUDX13 / 822281 AraportID:AT3G26690 Length:202 Species:Arabidopsis thaliana


Alignment Length:207 Identity:37/207 - (17%)
Similarity:70/207 - (33%) Gaps:74/207 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 KLSVPTYGAILVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLID 371
            ||.|     :::|..:.|.|:           ||||...::|.....|:||..||.|..      
plant    46 KLQV-----LMISSPNRHDLV-----------FPKGGWEDDETVLEAASREAMEEAGVK------ 88

  Fly   372 ANDYIEAFINYQYTRLYVVRNIPMDT-QFAPRTRN-EIKCCDWFRIDALPVNKNDAISKAKLGKT 434
                            .::|..|:.. :|..::.: |..||                    ||..
plant    89 ----------------GILREDPLGVWEFRSKSSSVEADCC--------------------LGGG 117

  Fly   435 SNSFFMIMPFVKRL----------KKWVNDRKAGIEPRRRKFSGQQSPKAASPTNMNGNCKKD-- 487
            ...:...:...:.|          ::|:|.::| :|..|.::......:........|:.|:|  
plant   118 CKGYMFALEVKEELAIWPEQDDRERRWLNVKEA-LELCRYEWMQSALEEFLRVMAEEGSTKEDSL 181

  Fly   488 -VTGVRNESQRQ 498
             ::.:.|..:||
plant   182 AISSISNRGERQ 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 26/159 (16%)
NUDX13NP_189303.1 NUDIX_DIPP2_like_Nudt4 21..166 CDD:467551 31/178 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.