DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and NUDT16

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_566428.1 Gene:NUDT16 / 820440 AraportID:AT3G12600 Length:180 Species:Arabidopsis thaliana


Alignment Length:169 Identity:36/169 - (21%)
Similarity:49/169 - (28%) Gaps:72/169 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 IPFL--------NKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYFARNSWGFPKG 342
            |||.        |...|.|.|:|                ::|......||           ||||
plant    26 IPFRYVNSDKDGNSESGKVIQVL----------------MISSSSGPGLL-----------FPKG 63

  Fly   343 KINENEDPAHCATREVYEETGFDITDLIDANDYIEAFI-NYQYT-------------------RL 387
            ....:|.....|.||..||.|        ....:..|: ||::.                   .|
plant    64 GWENDETVREAAAREAVEEAG--------VRGILMDFLGNYEFKSKSHQDEFSPEGLCKAAMYAL 120

  Fly   388 YVVRNIPMDTQFAPRTR------NEIKCC--DWFRIDAL 418
            ||...:....:...|||      ..::.|  .|.: |||
plant   121 YVKEELATWPEHETRTRKWLTIEEAVESCRHPWMK-DAL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265 8/27 (30%)
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 28/137 (20%)
NUDT16NP_566428.1 NUDIX_DIPP2_like_Nudt4 21..158 CDD:467551 34/167 (20%)

Return to query results.
Submit another query.