DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and NUDT17

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_565273.1 Gene:NUDT17 / 814696 AraportID:AT2G01670 Length:182 Species:Arabidopsis thaliana


Alignment Length:118 Identity:25/118 - (21%)
Similarity:40/118 - (33%) Gaps:24/118 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 ILVSEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGF--DITDLIDANDYIEA 378
            :::|....|.|:           ||||....:|.....|:||..||.|.  ::...:...|::..
plant    50 LVISSQKGHALM-----------FPKGGWELDESVEEAASRECLEEAGVLGNVEHQLGKWDFLSK 103

  Fly   379 FINYQYTRLYVVRNIPMDTQFAPR-----------TRNEIKCCDWFRIDALPV 420
            .....|..|.....:....:..|.           |.....|.||:..:||.|
plant   104 SRGTYYEGLMFPMLVTEQLELWPEQHVRQRIWMNVTEAREACRDWWMKEALDV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 25/118 (21%)
NUDT17NP_565273.1 NUDIX_DIPP2_like_Nudt4 26..157 CDD:467551 25/118 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.