DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and nudt19

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001122258.1 Gene:nudt19 / 794545 ZFINID:ZDB-GENE-081022-80 Length:397 Species:Danio rerio


Alignment Length:185 Identity:42/185 - (22%)
Similarity:60/185 - (32%) Gaps:68/185 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 GTVD--QILDEWK---NYKLSVPTYGAILVSEDHNHCLLVQSYFA--RNSWGFP-KGKINENEDP 350
            |.||  ....||:   |.....|.||..:|.:...   .....||  |:..|.| .|      |.
Zfish    70 GLVDASDFSSEWQELFNPFTKAPNYGVKVVKQSPE---TRPPIFATDRSQLGSPIPG------DV 125

  Fly   351 AH--CATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWF 413
            |.  ||.||.:||:|                         |:..:|.|.....|||:        
Zfish   126 AFRICAVRETFEESG-------------------------VLLALPKDEYSVTRTRS-------- 157

  Fly   414 RIDALPVNK-------NDAISKAK---LGKTSNSFFM-----IMPFVKRLKKWVN 453
             :|..|...       .:.:||.:   :|..:|...|     .:|.:..|.:|.|
Zfish   158 -LDTQPSLTRLSGQWGTEVLSKWRSRVIGDPANFIKMCRELQCLPNIWALHEWGN 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 6/17 (35%)
Dcp2p 310..459 CDD:239644 36/164 (22%)
nudt19NP_001122258.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.