DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and Dcp2

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_081766.1 Gene:Dcp2 / 70640 MGIID:1917890 Length:422 Species:Mus musculus


Alignment Length:457 Identity:164/457 - (35%)
Similarity:219/457 - (47%) Gaps:122/457 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 PEKSKIPSDILDDLASRFIINVPDMELNNLIRMCFQIELAHWFYLDFFCAPESGEDGETPKCVQR 268
            |::.:||..:||||.||||:::|..|.:|.||:||||||||||||||:.....|           
Mouse     3 PKRLEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPG----------- 56

  Fly   269 KLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYFA 333
             ||..||:.||..:|.|.|||......|::||||||.||:.|||||||::.|...:.||||.|.|
Mouse    57 -LPQCGIRDFAKAVFSHCPFLLPQGEDVEKILDEWKEYKMGVPTYGAIILDETLENVLLVQGYLA 120

  Fly   334 RNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQ 398
            ::.|||||||:|:.|.|..||.|||:|||||||.|.|..:||||..||.|..|||::..:|.||:
Mouse   121 KSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGVPKDTK 185

  Fly   399 FAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIMPFVKRLKKWVNDRKAGIEPRR 463
            |.|:||.||:..:||.|:.||.::||...|:|||...|.|||.:||::.|:.|::          
Mouse   186 FNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLS---------- 240

  Fly   464 RKFSGQQSPKAASPTNMNGNCKKDVTGVRNESQRQRHKSMGDLDGVKLNNLNGKGTVGTGAGSAA 528
            |:| |..|                                 |.|                     
Mouse   241 RRF-GDSS---------------------------------DSD--------------------- 250

  Fly   529 SASATAAINSMNICNSNGKRNKQNAAAGSNQATPTTIATPMTSNGAVVGGTVSSKRQLFHSQSQN 593
                            ||     .::|||..|.||......|.        ....:|||...|.:
Mouse   251 ----------------NG-----FSSAGSTPARPTVEKLSRTK--------FRHSQQLFPEGSPS 286

  Fly   594 D---------AQQSASNEKQIVSSFDLIRKEKQQQLKAAKAQKQQQQQQQRSRTK---SQSDKQY 646
            |         .|:|.||..::   .||: |.|.|.::....::.|....|:.|..   .|..||.
Mouse   287 DQWVKHRQPLQQKSHSNHGEV---SDLL-KAKNQNMRGNGRKQYQDSPNQKKRANGVHGQPAKQQ 347

  Fly   647 NP 648
            ||
Mouse   348 NP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 46/94 (49%)
Dcp2p 310..459 CDD:239644 76/148 (51%)
Dcp2NP_081766.1 DCP2 12..94 CDD:282833 46/93 (49%)
Dcp2p 97..246 CDD:239644 79/159 (50%)
Nudix box 129..150 12/20 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 247..347 31/186 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836903
Domainoid 1 1.000 133 1.000 Domainoid score I5061
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002974
OrthoInspector 1 1.000 - - oto94096
orthoMCL 1 0.900 - - OOG6_102623
Panther 1 1.100 - - LDO PTHR23114
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R299
SonicParanoid 1 1.000 - - X2325
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.