DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and Nudt11

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001388133.1 Gene:Nudt11 / 680248 RGDID:1594183 Length:164 Species:Rattus norvegicus


Alignment Length:127 Identity:36/127 - (28%)
Similarity:55/127 - (43%) Gaps:20/127 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 SEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGF--DITDLIDANDYIEAFIN 381
            ||..:..|||.|....:.|..|.|.:...|:|...|.||||||.|.  .:..|:...:..:...:
  Rat    27 SEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPDGAAVREVYEEAGVKGKLGRLLGVFEQNQDRKH 91

  Fly   382 YQYTRLYVVRNIPMDTQFA---PRTRNEIKCCDWFRI-DAL-------PVNKNDAISKAKLG 432
            ..|..:..|..:..|.:.:   .|.|      :||:| ||:       ||:. :.:.|.|||
  Rat    92 RTYVFVLTVTELLEDWEDSVSIGRKR------EWFKIEDAIKVLQCHKPVHA-EYLEKLKLG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 36/127 (28%)
Nudt11NP_001388133.1 NUDIX_DIPP2_like_Nudt4 18..143 CDD:467551 32/122 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.