DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DCP2 and Nudt3

DIOPT Version :9

Sequence 1:	NP_001246776.1	Gene:	DCP2 / 39722	FlyBaseID:	FBgn0036534	Length:	792	Species:	Drosophila melanogaster
Sequence 2:	NP_062811.1	Gene:	Nudt3 / 56409	MGIID:	1928484	Length:	168	Species:	Mus musculus

Alignment Length:	111	Identity:	32/111 - (28%)
Similarity:	46/111 - (41%)	Gaps:	19/111 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   319 SEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQ 383
            ||.....|||.|....:.|..|.|.:...|:|:..|.|||.||.|...|    ....:..|.|.:
Mouse    28 SESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGT----LGRLVGIFENQE 88

  Fly   384 -----YTRLYVVRNIPMDTQFA---PRTRNEIKCCDWFRI-DALPV 420
                 |..:.:|..:..|.:.:   .|.|      :||:| ||:.|
Mouse    89 RKHRTYVYVLIVTEVLEDWEDSVNIGRKR------EWFKIEDAIKV 128

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DCP2	NP_001246776.1	DCP2	212..307	CDD:282833
DCP2	NP_001246776.1	Dcp2p	310..459	CDD:239644	32/111 (29%)
Nudt3	NP_062811.1	Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	18..20
		Nudix_Hydrolase_9	19..134	CDD:240024	32/111 (29%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	39..41		1/1 (100%)
		Nudix box	51..72		9/20 (45%)
		Substrate binding. /evidence=ECO:0000250\|UniProtKB:O95989	89..91		0/1 (0%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0494
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810