DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and nudt4

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001005679.1 Gene:nudt4 / 448180 XenbaseID:XB-GENE-943736 Length:180 Species:Xenopus tropicalis


Alignment Length:138 Identity:37/138 - (26%)
Similarity:58/138 - (42%) Gaps:21/138 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 SEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFD-----ITDLIDANDYIEA 378
            :|..:..|||.|....:.|..|.|.:...|:|...|.||||||.|..     :..:.:..|....
 Frog    28 NEREDEVLLVSSSRYPDQWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGIFENQDRKHR 92

  Fly   379 FINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRI-DAL-------PVNKNDAISKAKLGKTS 435
            ...|..|...|:.:.. |:....|.|      :||:: |||       ||:. :.:.|.|||.:.
 Frog    93 TYVYVLTVTEVLEDWE-DSVNIGRKR------EWFKVEDALKVLQCHKPVHA-EYLEKLKLGCSP 149

  Fly   436 NSFFMIMP 443
            .:...::|
 Frog   150 TNGNSVVP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833
Dcp2p 310..459 CDD:239644 37/138 (27%)
nudt4NP_001005679.1 Nudix_Hydrolase_9 19..137 CDD:240024 32/115 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.