DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and CG42813

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001303547.1 Gene:CG42813 / 43276 FlyBaseID:FBgn0261995 Length:212 Species:Drosophila melanogaster


Alignment Length:100 Identity:23/100 - (23%)
Similarity:40/100 - (40%) Gaps:29/100 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 QRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSY 331
            ::||  |.::||...::..|  ::...||.|::     :.|...|..|..|     ..|      
  Fly    53 RQKL--VLVRQFRPAVYHGI--ISSAKGTFDEV-----DLKEFPPAIGVTL-----ELC------ 97

  Fly   332 FARNSWGFPKGKINENEDPAHCATREVYEETGFDI 366
                     .|.:::|:.....|..||.||.|:|:
  Fly    98 ---------AGIVDKNKSWVEIAREEVVEECGYDV 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 9/39 (23%)
Dcp2p 310..459 CDD:239644 13/56 (23%)
CG42813NP_001303547.1 ADPRase_NUDT5 41..205 CDD:239516 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.