DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and dcp2

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_956446.1 Gene:dcp2 / 393121 ZFINID:ZDB-GENE-040426-851 Length:397 Species:Danio rerio


Alignment Length:350 Identity:140/350 - (40%)
Similarity:192/350 - (54%) Gaps:72/350 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 EKSKIPSDILDDLASRFIINVPDMELNNLIRMCFQIELAHWFYLDFFCAPESGEDGETPKCVQRK 269
            ::.:||..:||||.||||:::|..|.:|.||:||||||||||||||              |:|..
Zfish     4 KRGEIPRGLLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDF--------------CMQNS 54

  Fly   270 --LPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYF 332
              ||..||:.||..:|.|.|||......|.::|::||.||:.|||:|||::.|..::.|:||.|.
Zfish    55 PGLPQCGIRDFAKAVFSHCPFLLPQGEDVQKVLEQWKEYKMGVPTFGAIILDETLDNVLMVQGYL 119

  Fly   333 ARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDT 397
            |::.|||||||:||:|....||.|||.|||||||.|.|....|||..|:.|..|||::..:|.||
Zfish   120 AKSGWGFPKGKVNEDEAFHDCAVREVLEETGFDIRDRICKKTYIEQRISDQLARLYIIPGVPKDT 184

  Fly   398 QFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIMPFVKRLKKWVNDRKA----- 457
            :|.|:||.||:..:||.::.||.::||...|:|||...|.|||.:||:::||:|:...|.     
Zfish   185 KFNPKTRKEIRNIEWFPVEKLPCHRNDMTPKSKLGLAPNKFFMAIPFMRQLKEWIAKHKGESTSS 249

  Fly   458 ---------------GIEPRRRKFSGQQSPKAA-----------------------SPTNM---N 481
                           ..:|||.:...:.||.:|                       .|.|.   |
Zfish   250 DEDFASNGSTPCKPFRSKPRRSQLLVESSPVSADSWSKQKQKIFVQTSQSELADVLKPKNHVKGN 314

  Fly   482 G-------NCKKDVTGVRNESQRQR 499
            |       |.||.|.||   ||:|:
Zfish   315 GRKHQESPNLKKRVNGV---SQQQK 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 44/96 (46%)
Dcp2p 310..459 CDD:239644 73/168 (43%)
dcp2NP_956446.1 DCP2 13..94 CDD:282833 44/94 (47%)
Dcp2p 97..246 CDD:239644 73/148 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580421
Domainoid 1 1.000 122 1.000 Domainoid score I5605
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002974
OrthoInspector 1 1.000 - - oto39681
orthoMCL 1 0.900 - - OOG6_102623
Panther 1 1.100 - - LDO PTHR23114
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R299
SonicParanoid 1 1.000 - - X2325
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.870

Return to query results.
Submit another query.