DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and Aps

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_648421.1 Gene:Aps / 39226 FlyBaseID:FBgn0036111 Length:177 Species:Drosophila melanogaster


Alignment Length:166 Identity:43/166 - (25%)
Similarity:70/166 - (42%) Gaps:24/166 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 SEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDL------IDANDYIE 377
            ||:....|||.|......|..|.|.:...|:.:..|.|||.||.|. :.||      .:.||::.
  Fly    28 SENEAEVLLVTSSRRPELWIVPGGGVEPEEESSVTAVREVLEEAGV-VGDLGRCLGVFENNDHMH 91

  Fly   378 AFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIM 442
            .      |.::|: |:..:......:|:..:...||.||       ||:|:..|.|.:...:::.
  Fly    92 R------TEVFVM-NVTQELDEWEDSRSIGRKRQWFTID-------DALSQLALHKPTQQHYLMQ 142

  Fly   443 PFVKRLKKWVNDRKAGIEPRRRKFSGQQSPKAASPT 478
              ::..|...|..:........|.:...:| |||||
  Fly   143 --LQHSKTLDNTNRVVNATHPPKLTNAATP-AASPT 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833
Dcp2p 310..459 CDD:239644 36/145 (25%)
ApsNP_648421.1 Nudix_Hydrolase_9 19..137 CDD:240024 34/123 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.