DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and Nudt7

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_038953791.1 Gene:Nudt7 / 361413 RGDID:1306719 Length:285 Species:Rattus norvegicus


Alignment Length:267 Identity:47/267 - (17%)
Similarity:87/267 - (32%) Gaps:101/267 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 ASTTKASSNKLPE----KSKIPSDILDDL-----------------ASRFIINVPDMELNNLIRM 236
            |:..|.::..:|.    :..:.::::||.                 .|::.:.:|.:.....:.:
  Rat    15 AACRKGTAGPMPRPCGLQESVRNNLIDDAKARLKKFDVGTRYSHLSPSKYSVLLPLLARGEKLYL 79

  Fly   237 CFQI----------ELAHWFYLDFFCAPESGED----GETPKCVQRKLPSVGIKQFAMQLFQH-I 286
            .|.:          |:         |.|....|    .:|...::.....||:....:::..| :
  Rat    80 LFTVRSDKLRRAPGEV---------CFPGGKRDPVDADDTATALREAQEEVGLHPHQVEVVSHLV 135

  Fly   287 P-FLNKHFGTVDQIL-------------DEWKNYKLSVPTYG-----------------AILVSE 320
            | |:||:  .:..|:             .|.:|..|..|..|                 ..||..
  Rat   136 PYFINKY--ALSNIVPFSVDVTSFPCPQQEERNNDLVTPVVGFLDPDFQAQPNADEVKDVFLVPL 198

  Fly   321 DHNHC--LLVQSYFARNSWGFPKGKINENEDP---------------AHCATREVYE-----ETG 363
            |:..|  :..||:|..:.:.|.. ...|..||               |..|...::|     ||.
  Rat   199 DYFLCPQVYYQSHFTHSGYHFVL-HCFEYTDPETGSKYLIKGMTSKLAVLAALIIFEKSPSFETE 262

  Fly   364 FDITDLI 370
            ||:.|||
  Rat   263 FDLHDLI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 20/140 (14%)
Dcp2p 310..459 CDD:239644 23/100 (23%)
Nudt7XP_038953791.1 CoAse 65..241 CDD:239518 31/187 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.