DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and Nudt5

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001007734.1 Gene:Nudt5 / 361274 RGDID:1359284 Length:219 Species:Rattus norvegicus


Alignment Length:181 Identity:42/181 - (23%)
Similarity:70/181 - (38%) Gaps:45/181 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 WKNYKLS------------VPTYGAILVSEDHNHCLLVQSYFARNSWG----FPKGKINENEDPA 351
            |:..||:            :|    :|....|:.|:::...|.....|    ||.|.|.:.|.|.
  Rat    46 WETVKLTTRKGKSADAVSVIP----VLQRTLHHECIVLVKQFRPPMGGYCLEFPAGLIEDGESPE 106

  Fly   352 HCATREVYEETGF--DITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFR 414
            ..|.||:.||||:  ||.:...|........|   ...:|| .:.::...|...|.:.|..|...
  Rat   107 AAALRELEEETGYKGDIAECSPAVCMDPGLSN---CTTHVV-TVTINGDDAGNVRPKPKPGDGEF 167

  Fly   415 IDALPVNKNDAISKA-KLG------------------KTSNSFFMIMPFVK 446
            ::.:.:.|||.:::. .||                  |.:|:....:||:|
  Rat   168 VEVISLPKNDLLTRLDALGAEDRLTVDARVYAYALALKHANAKPFEVPFLK 218

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 1/3 (33%)
Dcp2p 310..459 CDD:239644 39/162 (24%)