Sequence 1: | NP_001246776.1 | Gene: | DCP2 / 39722 | FlyBaseID: | FBgn0036534 | Length: | 792 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001260584.1 | Gene: | CG18094 / 35232 | FlyBaseID: | FBgn0032791 | Length: | 360 | Species: | Drosophila melanogaster |
Alignment Length: | 224 | Identity: | 40/224 - (17%) |
---|---|---|---|
Similarity: | 67/224 - (29%) | Gaps: | 114/224 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 320 EDHNHCLLV-----QSYFARNSWGFPKGKINENEDPA---------------------------- 351
Fly 352 --------H---------CATREVYEETGF-------DI-----------TDLI----------- 370
Fly 371 ---DANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLG 432
Fly 433 KTSNSFFMIMPFVKRLKKWVNDRKAGIEP 461 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DCP2 | NP_001246776.1 | DCP2 | 212..307 | CDD:282833 | |
Dcp2p | 310..459 | CDD:239644 | 38/220 (17%) | ||
CG18094 | NP_001260584.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0494 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |