DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and CG18094

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001260584.1 Gene:CG18094 / 35232 FlyBaseID:FBgn0032791 Length:360 Species:Drosophila melanogaster


Alignment Length:224 Identity:40/224 - (17%)
Similarity:67/224 - (29%) Gaps:114/224 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   320 EDHNHCLLV-----QSYFARNSWGFPKGKINENEDPA---------------------------- 351
            ||:::.||:     ::.:|.|...||.|..:..||.:                            
  Fly    24 EDYDYRLLLIKRTEKTSYALNHCVFPGGVFDPIEDQSAKWITFFKSFGVTDEQLKMCRHNQDSPR 88

  Fly   352 --------H---------CATREVYEETGF-------DI-----------TDLI----------- 370
                    |         .|.||.:||.|.       ||           |.|:           
  Fly    89 PEFLSGGDHISRDIALRLTALRETFEEVGILICTEQDDIQKWDSKSGHPRTVLLESSEHFEWQHR 153

  Fly   371 ---DANDYIEAFINYQYTRLYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLG 432
               ||:.::|.|.:|:     |:.|| ...|            :|              |..:..
  Fly   154 VHNDASQFLELFRHYK-----VIPNI-WSLQ------------EW--------------SIWRTA 186

  Fly   433 KTSNSFFMIMPFVKRLKKWVNDRKAGIEP 461
            .|:|..:..:.::..|.|:..:.|..:||
  Fly   187 ATANRKYDTVYYITMLDKYTRNIKLLLEP 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833
Dcp2p 310..459 CDD:239644 38/220 (17%)
CG18094NP_001260584.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.