DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and CG10194

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_609973.1 Gene:CG10194 / 35231 FlyBaseID:FBgn0032790 Length:351 Species:Drosophila melanogaster


Alignment Length:398 Identity:80/398 - (20%)
Similarity:138/398 - (34%) Gaps:132/398 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 YGAILVSEDHNHCLLVQS-------------------YFARNSW--------GFPKG-------- 342
            |.|:|::.......:.:|                   :|.||.:        |..||        
  Fly    30 YNALLLTRTQKSTFMPESSVFPGGVCDASDSSPAWLEHFQRNEFSAAKLRNVGHVKGPRPDIFHT 94

  Fly   343 KINENE-DPAHC----ATREVYEETGF----DITDLIDANDYIEAFINYQYTRL---YVVRNIPM 395
            |.::.. ||:..    |.||.:||.|.    |...|...:|| .||.: |:.|.   ::|.|  .
  Fly    95 KADKKSLDPSLALRLTAIRETFEELGILLCRDSKSLTSTSDY-GAFYD-QFDRAHWQHIVHN--N 155

  Fly   396 DTQFAPRTRNEIKCCDWFRIDALPVNKND--AISKAKLGKTSNSF---FMIMPFVKRLKKWVNDR 455
            .:||       ::.|.  ::|.||    |  ::.:..:.:|.::|   |....|:..|::   :.
  Fly   156 ASQF-------LELCK--QLDVLP----DVWSLHEWSVWRTPSTFKKRFETAFFMTALEQ---EP 204

  Fly   456 KAGIEPRRRKFSGQQSPKAASPTNMNGNCKKDVTGVRNESQRQRHKSMGDLDGVKLNNLNGKGTV 520
            :..|||...|.|..:||.    ..:..:.:|::.    ....|.::....|:...|:||      
  Fly   205 RVHIEPNEVKDSAWRSPL----DYLQASLRKELW----LPPPQFYELSRCLNFSSLDNL------ 255

  Fly   521 GTGAGSAASASATAAINSMNICNSNGKRNKQNAAAGSNQATPTTIATPMT---SNGAVVGGTVSS 582
                                         :|.||  ..:.....:..|:.   :||.|       
  Fly   256 -----------------------------RQFAA--EREVKGIQLIHPVVHKCTNGLV------- 282

  Fly   583 KRQLFHSQSQNDAQQSASNEK-QIVSSFDLIRKEKQQQLKAAKAQKQQQQQQQRSRTKSQSDKQY 646
              .|........|...||||| :|..|.:..|.:...:|.  :::...|.|.|......:.|.|.
  Fly   283 --HLLPGDDAYPADPDASNEKIEIDLSVEEFRSKTNAKLH--RSEHWNQHQSQLIIKFERDDGQV 343

  Fly   647 NPQQPVKI 654
            :|..|.|:
  Fly   344 HPLDPTKL 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833
Dcp2p 310..459 CDD:239644 41/197 (21%)
CG10194NP_609973.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.