DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and Dcp2

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001163940.1 Gene:Dcp2 / 291604 RGDID:1562909 Length:421 Species:Rattus norvegicus


Alignment Length:335 Identity:144/335 - (42%)
Similarity:194/335 - (57%) Gaps:38/335 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 EKSKIPSDILDDLASRFIINVPDMELNNLIRMCFQIELAHWFYLDFFCAPESGEDGETPKCVQRK 269
            ::.:||..:||||.||||:::|..|.:|.||:||||||||||||||:.....|            
  Rat     4 KRLEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPG------------ 56

  Fly   270 LPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYFAR 334
            ||..||:.||..:|.|.|||......|::||||||.||:.|||||||::.|...:.||||.|.|:
  Rat    57 LPQCGIRDFAKAVFSHCPFLLPQGEDVEKILDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAK 121

  Fly   335 NSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQF 399
            :.|||||||:|:.|.|..||.|||:|||||||.|.|..:||||..||.|..|||::..:|.||:|
  Rat   122 SGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGVPKDTKF 186

  Fly   400 APRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIMPFVKRLKKWVNDR--------- 455
            .|:||.||:..:||.|:.||.::||...|:|||...|.|||.:||::.|:.|::.|         
  Rat   187 NPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDN 251

  Fly   456 ---KAGIEP--------RRRKF-SGQQSPKAASPTNMNGNCKKDVTGVRNESQRQRHKSMGDLDG 508
               .||..|        .|.|| ..||.....||::.....::.:     :.:...|..:.||..
  Rat   252 GFSSAGSTPARPTVEKLSRTKFRHSQQLFPEGSPSDQWVKHRQPL-----QQKHSNHTEVSDLCK 311

  Fly   509 VKLNNLNGKG 518
            .|..|:.|.|
  Rat   312 AKNQNMRGNG 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 46/94 (49%)
Dcp2p 310..459 CDD:239644 78/160 (49%)
Dcp2NP_001163940.1 DCP2 12..94 CDD:282833 46/93 (49%)
Dcp2p 97..246 CDD:239644 77/148 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340620
Domainoid 1 1.000 133 1.000 Domainoid score I4924
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002974
OrthoInspector 1 1.000 - - otm45743
orthoMCL 1 0.900 - - OOG6_102623
Panther 1 1.100 - - LDO PTHR23114
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2325
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.