DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and ndx-4

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_493413.1 Gene:ndx-4 / 189639 WormBaseID:WBGene00003581 Length:138 Species:Caenorhabditis elegans


Alignment Length:111 Identity:28/111 - (25%)
Similarity:41/111 - (36%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 LLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAF----------I 380
            ||:|:.:..:.|..|||.::..||....|.||..||.......|....|..|..          :
 Worm    21 LLLQASYPPHHWTPPKGHVDPGEDEWQAAIRETKEEANITKEQLTIHEDCHETLFYEAKGKPKSV 85

  Fly   381 NYQYTRLYVVRNIPMDTQFAPRTRN--------EIKCCDWFRIDAL 418
            .|...:|    |.|.|.|.:...:|        .||..|:..:.:|
 Worm    86 KYWLAKL----NNPDDVQLSHEHQNWKWCELEDAIKIADYAEMGSL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 28/111 (25%)
ndx-4NP_493413.1 NUDIX_Ap4A_Nudt2 3..135 CDD:467534 28/111 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.