DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and ndx-3

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001380056.1 Gene:ndx-3 / 173857 WormBaseID:WBGene00003580 Length:240 Species:Caenorhabditis elegans


Alignment Length:203 Identity:48/203 - (23%)
Similarity:82/203 - (40%) Gaps:52/203 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 CVQRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSV--PTYGAILVSEDHNHCLL 327
            |.:|.......:||...| ..|| .:||...|.   |...|..:||  |     ||:.|....:|
 Worm    15 CSRRFFGKDAKEQFLKNL-SSIP-ASKHPRLVS---DSDANSAMSVLIP-----LVTVDGRDSVL 69

  Fly   328 V--QSYFARNSWG---FPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFI----NYQ 383
            :  :|...|:..|   ||.|:::..|.....|.||.:||.|.: .:.::...::::.|    ::.
 Worm    70 LTKRSIHLRSHRGEVCFPGGRMDPGETTTETALRETFEEIGVN-AESVEIWGHLKSVIRRQADFN 133

  Fly   384 YTRLY-------VVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMI 441
            .|.:.       |:.|:.:::       :|::......||.|       |.||.|.|..:     
 Worm   134 VTPIVGYISDERVLENLVVNS-------DEVQAVFTIPIDEL-------IKKAGLTKFQS----- 179

  Fly   442 MPFVKRLK 449
                ||:|
 Worm   180 ----KRMK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 12/41 (29%)
Dcp2p 310..459 CDD:239644 35/158 (22%)
ndx-3NP_001380056.1 CoAse 54..221 CDD:239518 36/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.