Sequence 1: | NP_001246776.1 | Gene: | DCP2 / 39722 | FlyBaseID: | FBgn0036534 | Length: | 792 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001380056.1 | Gene: | ndx-3 / 173857 | WormBaseID: | WBGene00003580 | Length: | 240 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 48/203 - (23%) |
---|---|---|---|
Similarity: | 82/203 - (40%) | Gaps: | 52/203 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 265 CVQRKLPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSV--PTYGAILVSEDHNHCLL 327
Fly 328 V--QSYFARNSWG---FPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFI----NYQ 383
Fly 384 YTRLY-------VVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMI 441
Fly 442 MPFVKRLK 449 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DCP2 | NP_001246776.1 | DCP2 | 212..307 | CDD:282833 | 12/41 (29%) |
Dcp2p | 310..459 | CDD:239644 | 35/158 (22%) | ||
ndx-3 | NP_001380056.1 | CoAse | 54..221 | CDD:239518 | 36/159 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0494 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |