DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and NUDT10

DIOPT Version :10

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_694853.1 Gene:NUDT10 / 170685 HGNCID:17621 Length:164 Species:Homo sapiens


Alignment Length:132 Identity:36/132 - (27%)
Similarity:55/132 - (41%) Gaps:30/132 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 SEDHNHCLLVQSYFARNSWGFPKGKINENEDPAHCATREVYEETGFD-----ITDLIDANDYIEA 378
            ||..:..|||.|....:.|..|.|.:...|:|...|.||||||.|..     :..:.:.|...: 
Human    27 SEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPK- 90

  Fly   379 FINYQYTRLYVVRNIPM-----DTQFAPRTRNEIKCCDWFRI-DAL-------PVNKNDAISKAK 430
                ..|.:||:....:     |:....|.|      :||:: ||:       ||:. :.:.|.|
Human    91 ----HRTYVYVLTVTELLEDWEDSVSIGRKR------EWFKVEDAIKVLQCHKPVHA-EYLEKLK 144

  Fly   431 LG 432
            ||
Human   145 LG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..306 CDD:428265
NUDIX_Dcp2p_Nudt20 310..458 CDD:467540 36/132 (27%)
NUDT10NP_694853.1 NUDIX_DIPP2_like_Nudt4 18..143 CDD:467551 32/127 (25%)
Nudix box 50..71 10/20 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..164 3/3 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.