DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and DCP2

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_689837.2 Gene:DCP2 / 167227 HGNCID:24452 Length:420 Species:Homo sapiens


Alignment Length:444 Identity:164/444 - (36%)
Similarity:224/444 - (50%) Gaps:82/444 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 EKSKIPSDILDDLASRFIINVPDMELNNLIRMCFQIELAHWFYLDFFCAPESGEDGETPKCVQRK 269
            ::.:||..:||||.||||:::|..|.:|.||:||||||||||||||:.....|            
Human     4 KRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPG------------ 56

  Fly   270 LPSVGIKQFAMQLFQHIPFLNKHFGTVDQILDEWKNYKLSVPTYGAILVSEDHNHCLLVQSYFAR 334
            ||..||:.||..:|.|.|||......|:::|||||.||:.|||||||::.|...:.||||.|.|:
Human    57 LPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAK 121

  Fly   335 NSWGFPKGKINENEDPAHCATREVYEETGFDITDLIDANDYIEAFINYQYTRLYVVRNIPMDTQF 399
            :.|||||||:|:.|.|..||.|||:|||||||.|.|..:||||..||.|..|||::..||.||:|
Human   122 SGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKF 186

  Fly   400 APRTRNEIKCCDWFRIDALPVNKNDAISKAKLGKTSNSFFMIMPFVKRLKKWVNDRKAGIEPRRR 464
            .|:||.||:..:||.|:.||.::||...|:|||...|.|||.:||::.|:.|::.|.........
Human   187 NPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDN 251

  Fly   465 KFSGQQSPKAASPTNMNGNCKKDVTGVRNESQ--------------RQ--------RHKSMGDLD 507
            .||...| ..|.||..    |...|..|:..|              ||        .|..|.|| 
Human   252 GFSSTGS-TPAKPTVE----KLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDL- 310

  Fly   508 GVKLNNLNGKGTVGTGAGSAASASATAAINSMNICNSNGKRNKQNAAAGSNQATPTTIATPMTSN 572
                  |.||.                  .||   ..||::..|::   .||...|....|....
Human   311 ------LKGKN------------------QSM---RGNGRKQYQDS---PNQKKRTNGLQPAKQQ 345

  Fly   573 GAVVGGTVSSKRQLFHSQSQNDAQQSASNEKQIVSSFDLIRKEKQQQLKAAKAQ 626
            .::    :..:::|...:.|::.:..|        .:||....:.|.|:.|:.|
Human   346 NSL----MKCEKKLHPRKLQDNFETDA--------VYDLPSSSEDQLLEHAEGQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 45/94 (48%)
Dcp2p 310..459 CDD:239644 78/148 (53%)
DCP2NP_689837.2 DCP2 12..93 CDD:309943 39/80 (49%)
Dcp2p 97..246 CDD:239644 82/148 (55%)
Nudix box 129..150 11/20 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..266 3/19 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..344 5/30 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146958
Domainoid 1 1.000 133 1.000 Domainoid score I5083
eggNOG 1 0.900 - - E1_COG0494
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002974
OrthoInspector 1 1.000 - - oto90508
orthoMCL 1 0.900 - - OOG6_102623
Panther 1 1.100 - - LDO PTHR23114
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R299
SonicParanoid 1 1.000 - - X2325
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.