DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DCP2 and NUDT5

DIOPT Version :9

Sequence 1:NP_001246776.1 Gene:DCP2 / 39722 FlyBaseID:FBgn0036534 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_054861.2 Gene:NUDT5 / 11164 HGNCID:8052 Length:219 Species:Homo sapiens


Alignment Length:172 Identity:38/172 - (22%)
Similarity:65/172 - (37%) Gaps:38/172 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 KHFGTVDQILDEWKNYKLSVPTY------------------------GA----ILVSEDHNHCLL 327
            |.:...::::.|.|..||...||                        |.    :|....|..|::
Human    14 KQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIV 78

  Fly   328 VQSYFARNSWG----FPKGKINENEDPAHCATREVYEETGF--DITDLIDANDYIEAFINYQYTR 386
            :...|.....|    ||.|.|::.|.|...|.||:.||||:  ||.:...|........|   ..
Human    79 LVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSN---CT 140

  Fly   387 LYVVRNIPMDTQFAPRTRNEIKCCDWFRIDALPVNKNDAISK 428
            :::| .:.::...|...|.:.|..|...::.:.:.|||.:.:
Human   141 IHIV-TVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQR 181

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
DCP2NP_001246776.1 DCP2 212..307 CDD:282833 3/15 (20%)
Dcp2p 310..459 CDD:239644 33/153 (22%)