DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fwe and TVP18

DIOPT Version :9

Sequence 1:NP_648804.1 Gene:fwe / 39720 FlyBaseID:FBgn0261722 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_013787.1 Gene:TVP18 / 855093 SGDID:S000004675 Length:167 Species:Saccharomyces cerevisiae


Alignment Length:112 Identity:31/112 - (27%)
Similarity:53/112 - (47%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVA-GILQMVAGFVVMLLEAPCCF-VCFGQVN- 91
            || |..|.:.....|..|:.|:|     .||.::| ||:.::.|.|::.:|.|... :|....| 
Yeast    26 YG-RWFGYINIILCIALGIANLF-----HVSGVIAFGIISIIQGLVILFIEIPFLLKICPLSDNF 84

  Fly    92 -EIAEKVESKPLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGV 137
             |..::.|:..  :|...|:|||   ||....:|.:..|.::...|:
Yeast    85 IEFIKRFETNG--WRCLFYLAMA---IIQYISIAVMATSLIVVAVGL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fweNP_648804.1 Cg6151-P 36..147 CDD:198145 28/106 (26%)
TVP18NP_013787.1 Cg6151-P 30..141 CDD:402026 28/107 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13314
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.