DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fwe and Cacfd1

DIOPT Version :9

Sequence 1:NP_648804.1 Gene:fwe / 39720 FlyBaseID:FBgn0261722 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_084138.1 Gene:Cacfd1 / 381356 MGIID:1924317 Length:171 Species:Mus musculus


Alignment Length:148 Identity:54/148 - (36%)
Similarity:82/148 - (55%) Gaps:14/148 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GPEQP-------WYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVAGILQMVAGFVVMLL 78
            ||..|       |:.::..||.|::.|....:.||:|..:|..|:::   ||:..::..|:::|.
Mouse    12 GPAPPAQEEGMTWWYRWLCRLAGVLGAVSCAISGLFNCVTIHPLNIA---AGVWMIMNAFILLLC 73

  Fly    79 EAP-CC-FVCFGQVNEIAEKVESKPLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGM 141
            ||| || ||.|  .|.:||||:....:.:|..|..|||.||::...|.:|.|:.:.|.|||:||:
Mouse    74 EAPFCCQFVEF--ANTVAEKVDRLRSWQKAVFYCGMAIVPIVMSLTLTTLLGNAIAFATGVLYGL 136

  Fly   142 MALGKKASAEDMRAAAQQ 159
            .|||||..|.......||
Mouse   137 SALGKKGDAISYARIQQQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fweNP_648804.1 Cg6151-P 36..147 CDD:198145 43/112 (38%)
Cacfd1NP_084138.1 Cg6151-P 34..142 CDD:198145 43/112 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837915
Domainoid 1 1.000 77 1.000 Domainoid score I8864
eggNOG 1 0.900 - - E1_KOG4085
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 87 1.000 Inparanoid score I5136
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48887
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007079
OrthoInspector 1 1.000 - - oto92124
orthoMCL 1 0.900 - - OOG6_107696
Panther 1 1.100 - - LDO PTHR13314
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.