DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fwe and Cacfd1

DIOPT Version :9

Sequence 1:NP_648804.1 Gene:fwe / 39720 FlyBaseID:FBgn0261722 Length:194 Species:Drosophila melanogaster
Sequence 2:NP_001100031.1 Gene:Cacfd1 / 296599 RGDID:1311501 Length:171 Species:Rattus norvegicus


Alignment Length:159 Identity:56/159 - (35%)
Similarity:88/159 - (55%) Gaps:11/159 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ITGLLARPNQQDPIGPEQ----PWYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVAGIL 67
            ::|.:|......|:.|.|    .|:.::..||.|::.|....:.||:|..:|..|:::   ||:.
  Rat     1 MSGSVAAGAAAGPVPPAQEEGMTWWYRWLCRLAGVLGAVSCAISGLFNCVTIHPLNIA---AGVW 62

  Fly    68 QMVAGFVVMLLEAP-CC-FVCFGQVNEIAEKVESKPLYFRAGLYIAMAIPPIILCFGLASLFGSG 130
            .::..|:::|.||| || ||.|  .|.:||||:....:.:|..|..|||.||::...|.:|.|:.
  Rat    63 MIMNAFILLLCEAPFCCQFVEF--ANTVAEKVDRLRSWQKAVFYCGMAIVPIVMSLTLTTLLGNA 125

  Fly   131 LIFGTGVVYGMMALGKKASAEDMRAAAQQ 159
            :.|.|||:||:.|||||..|.......||
  Rat   126 IAFATGVLYGLSALGKKGDAISYARIQQQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fweNP_648804.1 Cg6151-P 36..147 CDD:198145 43/112 (38%)
Cacfd1NP_001100031.1 Cg6151-P 34..142 CDD:198145 43/112 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341694
Domainoid 1 1.000 77 1.000 Domainoid score I8665
eggNOG 1 0.900 - - E1_KOG4085
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5034
OMA 1 1.010 - - QHG48887
OrthoDB 1 1.010 - - D1295049at2759
OrthoFinder 1 1.000 - - FOG0007079
OrthoInspector 1 1.000 - - oto95691
orthoMCL 1 0.900 - - OOG6_107696
Panther 1 1.100 - - LDO PTHR13314
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.