DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fwe and cacfd1

DIOPT Version :9

Sequence 1:NP_648804.1 Gene:fwe / 39720 FlyBaseID:FBgn0261722 Length:194 Species:Drosophila melanogaster
Sequence 2:XP_002665917.1 Gene:cacfd1 / 100333889 ZFINID:ZDB-GENE-120215-178 Length:168 Species:Danio rerio


Alignment Length:148 Identity:43/148 - (29%)
Similarity:77/148 - (52%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WYLKYGSRLLGIVAAFFAILFGLWNVFSIITLSVSCLVAGILQMVAGFVVMLLEAP-CC-FVCFG 88
            |:.::..:|.|::........|:||..::..|:::   ||:..::..||:.|.|.| || ||.| 
Zfish    21 WWYRWICKLAGVLGGISCATMGVWNCVTVHPLNIA---AGVWMVLTAFVLFLCEVPFCCQFVEF- 81

  Fly    89 QVNEIAEKVESKPLYFRAGLYIAMAIPPIILCFGLASLFGSGLIFGTGVVYGMMALGKKASA--- 150
             .|.:|.:.:....:.:|..|..||:.|:.|.|.:.:|.|:.:.|.|||:||:.:||||..|   
Zfish    82 -ANAVAARADRLKPWQKALFYCGMALFPVFLSFSITTLVGNAIAFATGVLYGLASLGKKGDAVSY 145

  Fly   151 ---EDMRAAAQQTFGGNT 165
               :..:...::...|.|
Zfish   146 ARLQHQKQGDEEKLAGTT 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fweNP_648804.1 Cg6151-P 36..147 CDD:198145 36/112 (32%)
cacfd1XP_002665917.1 Cg6151-P 31..139 CDD:198145 36/112 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581705
Domainoid 1 1.000 70 1.000 Domainoid score I9523
eggNOG 1 0.900 - - E1_KOG4085
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5244
OMA 1 1.010 - - QHG48887
OrthoDB 1 1.010 - - D1295049at2759
OrthoFinder 1 1.000 - - FOG0007079
OrthoInspector 1 1.000 - - oto38722
orthoMCL 1 0.900 - - OOG6_107696
Panther 1 1.100 - - LDO PTHR13314
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4124
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.