DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comm and comm2

DIOPT Version :9

Sequence 1:NP_001261891.1 Gene:comm / 39717 FlyBaseID:FBgn0010105 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_648801.2 Gene:comm2 / 39716 FlyBaseID:FBgn0041160 Length:343 Species:Drosophila melanogaster


Alignment Length:353 Identity:88/353 - (24%)
Similarity:141/353 - (39%) Gaps:100/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SAPASSMSPAAIAEHLQQN----QITFEIPSAHDLRHIDALNSFNALLQRIGNAAVSYDPAPPSG 85
            |:|.:|.......:.:..:    ||..:|.|:..|:|...||.            ||:       
  Fly    35 SSPEASTPTITTLDAISSSDFLKQIGQQILSSIQLKHQHQLNE------------VSH------- 80

  Fly    86 WSPDGSISTE----QLSKSVVLDLADLRDRSEESGESSWWSQIFGDADMHVIINYLWIGVVSSLV 146
              |..|.|.|    .|:..|:||             ||...|:....:....:|.:|||:|.:|:
  Fly    81 --PRNSTSEEIMDFDLANRVILD-------------SSSVDQLQQQLEYDKFMNEVWIGIVFTLI 130

  Fly   147 ILSLVFILFSCYFYRKFRTWKKCNKDIRAQIHAASDSYSSHLVGCDASRLLLHQQMQHPHHRSSE 211
            ::|:||.:.||:.|.:|||||      |...:.|:.|....:|..:|.:|       ||      
  Fly   131 LISMVFCICSCFLYHQFRTWK------RNYRNNANGSTQCTIVDIEALKL-------HP------ 176

  Fly   212 AGFYQIESP-PCYTIATGLPSYDEALHHQPRHFAYGMKFVYPSLAAVHHHHHCISNWEKQEPLNK 275
                .:|.| |.||:.:|||||:.||....:........||||:..|.:... .|:.|.|.|   
  Fly   177 ----DVEDPVPEYTLVSGLPSYEAALELLQKSPQSSCLIVYPSVFNVFNKQE-RSSQELQHP--- 233

  Fly   276 LQKCKLSAAAAVEEDKADSSSSTSASASPSSSESSNLATATPAICIN----MPSGRQDEEVDNSD 336
                                 ..:.||.|::.| ::||..||:.|..    :|:.........:.
  Fly   234 ---------------------GVATSAPPAAPE-NHLAPQTPSFCDATMPLLPATTAAAATHAAA 276

  Fly   337 SDSAIAVAVAVAQSLQPAAPADDDCASL 364
            :.:|:..|.|.:.:| .|:|.   |.|:
  Fly   277 TVTAVTAATATSATL-AASPT---CESI 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
commNP_001261891.1 Comm 128..257 CDD:292579 41/129 (32%)
comm2NP_648801.2 Comm 113..224 CDD:292579 42/133 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BYRM
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012734
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.