DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comm and comm3

DIOPT Version :9

Sequence 1:NP_001261891.1 Gene:comm / 39717 FlyBaseID:FBgn0010105 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001287072.1 Gene:comm3 / 39696 FlyBaseID:FBgn0259236 Length:423 Species:Drosophila melanogaster


Alignment Length:332 Identity:82/332 - (24%)
Similarity:136/332 - (40%) Gaps:76/332 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TVETTTTAEEL--YAEYISAPASSMSPAAIAEHLQQNQITFEIPSAHDLRHIDALNSFNALLQRI 71
            |..|||.:|.|  .|..:.|.||:.|    .|.|             ||...|...:::.|:.::
  Fly    28 TATTTTLSEGLNGNATTLDAAASTSS----GEKL-------------DLGGFDLPGNYSILINKL 75

  Fly    72 GNAAVSYDPAPPSGWSPDGSISTEQLSKSVVL-------DLADLRD--------RSEESGESSWW 121
            ...|:..|.|.       |:.:.::....:.|       |:||:.|        ........:..
  Fly    76 EQLALGLDSAL-------GNFTIDRQEVEINLSGAATANDVADVADDLFDVLPAARAPPPHIAHG 133

  Fly   122 SQIF-GD--ADMHVIINYLWIGVVSSLVILSLVFILFSCYFYRKFRTWKKCNKDIRAQIHAASDS 183
            |:|: ||  .|...:::.:||||:.:|:|:.::|.:.:|:.|.||:.||   ...||. |  ||.
  Fly   134 SRIYTGDDGQDFAHVVSDIWIGVILTLLIVFVIFFICACFVYHKFQQWK---NSYRAN-H--SDP 192

  Fly   184 YSSHLVGCDASRLLLHQQMQHPHHRSSEAGFYQIESPPCYTIATGLPSYDEALHHQPRHFAYGMK 248
            .......|...                    |:.||.|.|||.:|||:||:||    ..|.....
  Fly   193 TIEICRRCPPD--------------------YEAESLPSYTIVSGLPTYDDAL----EEFRKAGI 233

  Fly   249 FVYPSLAAVHHHHHCISNWEKQEPLNKLQKCKL-SAAAAVEEDKADSSSSTSASASPSSSESSNL 312
            .:.|::..:.....|....::|.....|.:..: ||.||.:.....|::....::||:||..| .
  Fly   234 ILTPAMVPIIKIFECNETGKEQAVGYSLVETNIASADAAADNVSLASTTCNCGNSSPTSSLPS-Y 297

  Fly   313 ATATPAI 319
            :.||.|:
  Fly   298 SAATAAV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
commNP_001261891.1 Comm 128..257 CDD:292579 36/128 (28%)
comm3NP_001287072.1 Comm 144..247 CDD:292579 36/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BYRM
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012734
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.