DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment comm2 and comm

DIOPT Version :9

Sequence 1:NP_648801.2 Gene:comm2 / 39716 FlyBaseID:FBgn0041160 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001261891.1 Gene:comm / 39717 FlyBaseID:FBgn0010105 Length:370 Species:Drosophila melanogaster


Alignment Length:353 Identity:88/353 - (24%)
Similarity:141/353 - (39%) Gaps:100/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SSPEASTPTITTLDAISSSDFLKQIGQQILSSIQLKHQHQLNE------------VSH------- 80
            |:|.:|.......:.:..:    ||..:|.|:..|:|...||.            ||:       
  Fly    25 SAPASSMSPAAIAEHLQQN----QITFEIPSAHDLRHIDALNSFNALLQRIGNAAVSYDPAPPSG 85

  Fly    81 --PRNSTSEEIMDFDLANRVILD-------------SSSVDQLQQQLEYDKFMNEVWIGIVFTLI 130
              |..|.|.|    .|:..|:||             ||...|:....:....:|.:|||:|.:|:
  Fly    86 WSPDGSISTE----QLSKSVVLDLADLRDRSEESGESSWWSQIFGDADMHVIINYLWIGVVSSLV 146

  Fly   131 LISMVFCICSCFLYHQFRTWK------RNYRNNANGSTQCTIVDIEALKL-------HP------ 176
            ::|:||.:.||:.|.:|||||      |...:.|:.|....:|..:|.:|       ||      
  Fly   147 ILSLVFILFSCYFYRKFRTWKKCNKDIRAQIHAASDSYSSHLVGCDASRLLLHQQMQHPHHRSSE 211

  Fly   177 ----DVEDPVPEYTLVSGLPSYEAALELLQKSPQSSCLIVYPSVFNVFNKQE-RSSQELQHP--- 233
                .:|.| |.||:.:|||||:.||....:........||||:..|.:... .|:.|.|.|   
  Fly   212 AGFYQIESP-PCYTIATGLPSYDEALHHQPRHFAYGMKFVYPSLAAVHHHHHCISNWEKQEPLNK 275

  Fly   234 ---------------------GVATSAPPAAPE-NHLAPQTPSFCDATMPLLPATTAAAATHAAA 276
                                 ..:.||.|::.| ::||..||:.|..    :|:.........:.
  Fly   276 LQKCKLSAAAAVEEDKADSSSSTSASASPSSSESSNLATATPAICIN----MPSGRQDEEVDNSD 336

  Fly   277 TVTAVTAATATSATL-AASPT---CESI 300
            :.:|:..|.|.:.:| .|:|.   |.|:
  Fly   337 SDSAIAVAVAVAQSLQPAAPADDDCASL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
comm2NP_648801.2 Comm 113..224 CDD:292579 42/133 (32%)
commNP_001261891.1 Comm 128..257 CDD:292579 41/129 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BYRM
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012734
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.