DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant8 and GALNT17

DIOPT Version :9

Sequence 1:NP_648800.1 Gene:Pgant8 / 39715 FlyBaseID:FBgn0036529 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_071924.1 Gene:GALNT17 / 64409 HGNCID:16347 Length:598 Species:Homo sapiens


Alignment Length:607 Identity:181/607 - (29%)
Similarity:286/607 - (47%) Gaps:122/607 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KVLPLLLLMAIGSIIYYL--------------YTLKLEGERDESATSTTSRLERDIRDLQAVFES 61
            |||.:|.|:|:...:.:|              :.::...|....:..:.|.::..:....::.|.
Human     8 KVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLED 72

  Fly    62 EVIPDLGAL----------------GRPARGNWTEEQLEAIAKSQRET-GYNAWLSKRISPERSL 109
            .|...|..|                |.||..:..||:.   ||...|. |||::||::||.:||:
Human    73 IVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEK---AKGPHEKYGYNSYLSEKISLDRSI 134

  Fly   110 YDMRHRSCKKLKYPMEKLPSVSVVITYHNEEASVLLRTLSSLRSRTPIQLLREVILVDDGSTQAD 174
            .|.|...||:|||..: ||.:|::..:.||..||:||::.|..:.||..||:|:|||||.|.:.:
Human   135 PDYRPTKCKELKYSKD-LPQISIIFIFVNEALSVILRSVHSAVNHTPTHLLKEIILVDDNSDEEE 198

  Fly   175 EK--LNDFIKIKFLNMVQHRRITTQVGLMHARVVGAELALADVLVFLDSHVEVTKGWLEPLIAPI 237
            .|  |.:::..::..:|:..|...:.||:.||:.|.::|...|..|.|:|||.|.||.||:::.|
Human   199 LKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQVTGFFDAHVEFTAGWAEPVLSRI 263

  Fly   238 LEDNRTCTTPIIDTIDFDNFAYRRGKPSRGFFNWEF--NYIQLPLLKEEAVAMPAPHKNPIMNGG 300
            .|:.:....|.||.|..|||..:|.:.|...::||.  .||..|....:|.....|.:.|.|.|.
Human   264 QENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELWCMYISPPKDWWDAGDPSLPIRTPAMIGC 328

  Fly   301 LFAIGREWFSELGGYDKGLKIWGAEQFELSLKLWLCGGQILEVPCSRVGHLFRDG---NFQIRYT 362
            .|.:.|::|.|:|..|.|:.::|.|..||.:|:|||||.:..:|||||.|:.|..   |..|.:.
Human   329 SFVVNRKFFGEIGLLDPGMDVYGGENIELGIKVWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFY 393

  Fly   363 NKDKNSEKKLISRNYRRVAEIWLDEYKDKLFA--NMP-HLTVIPVGNLAEQRDLKNRLHCKPFKW 424
            .|          ||..||||:|:|:||..::.  |:| ....|.:|:::|:|.|:..|.||.|:|
Human   394 TK----------RNALRVAEVWMDDYKSHVYIAWNLPLENPGIDIGDVSERRALRKSLKCKNFQW 448

  Fly   425 FLDNLATDFLNLYPILDPAEY----ASGVLQSISSPKLCLDRKD---------PSHG-------- 468
            :||       ::||  :...|    |.|.|::..:..:|||:..         |.||        
Human   449 YLD-------HVYP--EMRRYNNTVAYGELRNNKAKDVCLDQGPLENHTAILYPCHGWGPQLARY 504

  Fly   469 ------------------------------QPKLAPCSSDHVFPSPEQYWS-LTNHRELRSGF-Y 501
                                          .|:|..|  |.|..|..:.|: :.|...:..|. .
Human   505 TKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLDC--DKVKSSLYKRWNFIQNGAIMNKGTGR 567

  Fly   502 CLEVRNH---GVNVHIYQCHGQ 520
            ||||.|.   |:::.:..|.||
Human   568 CLEVENRGLAGIDLILRSCTGQ 589

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant8NP_648800.1 GT2 128..427 CDD:224137 111/308 (36%)
pp-GalNAc-T 131..430 CDD:133004 112/308 (36%)
Ricin_B_lectin 446..570 CDD:279046 27/127 (21%)
RICIN 448..572 CDD:238092 26/125 (21%)
GALNT17NP_071924.1 Catalytic subdomain A 151..262 42/110 (38%)
pp-GalNAc-T 155..454 CDD:133004 112/315 (36%)
Catalytic subdomain B 319..381 27/61 (44%)
RICIN 467..593 CDD:238092 26/125 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152513
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.