DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant8 and CG10000

DIOPT Version :9

Sequence 1:NP_648800.1 Gene:Pgant8 / 39715 FlyBaseID:FBgn0036529 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_651630.3 Gene:CG10000 / 43394 FlyBaseID:FBgn0039596 Length:558 Species:Drosophila melanogaster


Alignment Length:522 Identity:177/522 - (33%)
Similarity:265/522 - (50%) Gaps:90/522 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 YNAWLSKRISPERSLYDMRHRSCKK----LKYPMEKLPSVSVVITYHNEEASVLLRTLSSLRSRT 155
            ||..||..:...|.|...||.||..    |..|:|  .:|||||::|||..|:||||:.||.||:
  Fly    75 YNIHLSNALGLIRKLPVTRHHSCTTRNSILPAPLE--ANVSVVISFHNEARSMLLRTIVSLLSRS 137

  Fly   156 PIQLLREVILVDDGSTQADEKLNDFIK--------------IKFLNMVQHRRITTQVGLMHARVV 206
            |...|.|:||||||| |.|..|.|.:|              :.||      |...::||:.:|..
  Fly   138 PEDYLHELILVDDGS-QRDVTLLDDLKRWMGGVFGSRYRLGLTFL------RNQERMGLIWSRNR 195

  Fly   207 GAELALADVLVFLDSHVEVTKGWLEPLIAPILEDNRTCTTPIIDTIDFDNFAYRRGKP-SRGFFN 270
            ||.||....::|||||.||.:||||||:..:..:.....:|::|.||....:||:|.. .:|.|:
  Fly   196 GASLASGRYVLFLDSHCEVNEGWLEPLLERLALNTNLAVSPLLDPIDPTTLSYRKGNELLKGGFD 260

  Fly   271 W--EFNYIQLPLLKEEAVAMPAPHKNPIMNGGLFAIGREWFSELGGYDKGLKIWGAEQFELSLKL 333
            |  .|::::..|..:|::.|  |:::|...||:..:.||||.:||.::..|||||.|..||::||
  Fly   261 WSLHFHWLKRQLTNQESLEM--PYQSPAFAGGVLMMSREWFLKLGSFNPYLKIWGGESIELAIKL 323

  Fly   334 WLCGGQILEVPCSRVGHLFRDGN-FQI-RYTNKDKNSEKKLISRNYRRVAEIWLDEYKDKLFANM 396
            |||||||..|||||:||:||..: |.. ..:::..:..::....|.:.:||.||||||:..:|..
  Fly   324 WLCGGQIEIVPCSRIGHIFRRRHAFDFPPQSDRQLSPAQETYLHNSKIIAESWLDEYKNMFYALR 388

  Fly   397 PHLTVIPVGNLAE--QRDLKNRLHCKPFKWFLDNLATDFLNLYPILDPAEYASGVLQSISSPKLC 459
            |....||:.:..:  ||..|.| .|.||:|:|.:::.:....:..|.    |:|.|:   :...|
  Fly   389 PAARRIPLDHTYDELQRMRKER-RCHPFEWYLRHVSPELRMHFDELS----ATGTLR---NEDRC 445

  Fly   460 LD--RKDPSHGQPKLAPCSSDHVFPSPEQYWS-------LTNHRELRSGFYCLEVRNHGVNVHIY 515
            :.  :||   .||.||.|     :.|....||       |:.||||     ||.| ..|:.:.:.
  Fly   446 VHARQKD---SQPILASC-----YLSDITQWSMLRQSGQLSTHREL-----CLAV-GFGMRIALE 496

  Fly   516 QCHGQSGNQFWSFDSKTHQVISGQQQNFR---HCLEAQPEL-------NAVTSSVCDPKNHKQQW 570
            .| |:            ::.:...|:..|   |.|.|:..|       :.:..|.|......|.:
  Fly   497 PC-GR------------NETVRRSQRWVRLGTHLLHAESHLCLDNPLKDRLEMSTCRSHAVSQSF 548

  Fly   571 KF 572
            :|
  Fly   549 QF 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant8NP_648800.1 GT2 128..427 CDD:224137 127/319 (40%)
pp-GalNAc-T 131..430 CDD:133004 127/319 (40%)
Ricin_B_lectin 446..570 CDD:279046 34/142 (24%)
RICIN 448..572 CDD:238092 33/142 (23%)
CG10000NP_651630.3 pp-GalNAc-T 113..422 CDD:133004 127/318 (40%)
Ricin_B_lectin 435..548 CDD:279046 34/142 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.