DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant8 and Pgant4

DIOPT Version :10

Sequence 1:NP_648800.1 Gene:Pgant8 / 39715 FlyBaseID:FBgn0036529 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_722910.2 Gene:Pgant4 / 261610 FlyBaseID:FBgn0051956 Length:644 Species:Drosophila melanogaster


Alignment Length:73 Identity:18/73 - (24%)
Similarity:28/73 - (38%) Gaps:11/73 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TDSEVTSLAASSPARSPRR-PVYYVQSPSRDSHDGEKTATSFHSTP-------VLSPMGSPPHSH 61
            |:.::..:..:..:..||. .|.....||..|..|......|.|.|       ||..:.:.|   
  Fly   186 TNEDLRKMIINFTSYRPRECRVMRDNRPSFGSAAGRSRGYGFVSFPKHEIALDVLRKLNNNP--- 247

  Fly    62 SSMGRHSR 69
            |..|::||
  Fly   248 SVFGKNSR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant8NP_648800.1 pp-GalNAc-T 131..430 CDD:133004
beta-trefoil_Ricin_Pgant8-like 445..573 CDD:467339
Pgant4NP_722910.2 pp-GalNAc-T 181..480 CDD:133004 18/73 (25%)
beta-trefoil_Ricin_Pgant9-like 493..629 CDD:467340
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.