DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant8 and GALNT2

DIOPT Version :9

Sequence 1:NP_648800.1 Gene:Pgant8 / 39715 FlyBaseID:FBgn0036529 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_016856452.1 Gene:GALNT2 / 2590 HGNCID:4124 Length:636 Species:Homo sapiens


Alignment Length:560 Identity:178/560 - (31%)
Similarity:270/560 - (48%) Gaps:110/560 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RHKKKVLPLLLLMAIGSIIYYLYT---LKLEG------ERDESATSTTSRLERDIRDL---QAVF 59
            |..:.:|....|..:| |.||:|:   ..|.|      .|.|.........::|:...   :...
Human     3 RRSRMLLCFAFLWVLG-IAYYMYSGGGSALAGGAGGGAGRKEDWNEIDPIKKKDLHHSNGEEKAQ 66

  Fly    60 ESEVIPDLGALGRPARGNWTEEQLEA-----IAKSQRE----TGYNAWLSKRISPERSLYDMRHR 115
            ..|.:|       |.:..|.:...||     :.:|.::    ..:|...|.::..:|::.|.||.
Human    67 SMETLP-------PGKVRWPDFNQEAYVGGTMVRSGQDPYARNKFNQVESDKLRMDRAIPDTRHD 124

  Fly   116 SCKKLKYPMEKLPSVSVVITYHNEEASVLLRTLSSLRSRTPIQLLREVILVDDGSTQADE--KLN 178
            .|::.::.:: ||:.|||||:|||..|.||||:.|:..::|..|::|:|||||.|...::  .|.
Human   125 QCQRKQWRVD-LPATSVVITFHNEARSALLRTVVSVLKKSPPHLIKEIILVDDYSNDPEDGALLG 188

  Fly   179 DFIKIKFLNMVQHRRITTQVGLMHARVVGAELALADVLVFLDSHVEVTKGWLEPLIAPILEDNRT 243
            ...|::.|      |...:.|||.:||.||:.|.|.||.|||||.|..:.|||||:..:.||...
Human   189 KIEKVRVL------RNDRREGLMRSRVRGADAAQAKVLTFLDSHCECNEHWLEPLLERVAEDRTR 247

  Fly   244 CTTPIIDTIDFDNFAYRRGKPS-RGFFNW----EFNYIQLPLLKEEAVAMP-APHKNPIMNGGLF 302
            ..:||||.|:.|||.|...... :|.|:|    :::|: .|..:......| ||.|.|::.||||
Human   248 VVSPIIDVINMDNFQYVGASADLKGGFDWNLVFKWDYM-TPEQRRSRQGNPVAPIKTPMIAGGLF 311

  Fly   303 AIGREWFSELGGYDKGLKIWGAEQFELSLKLWLCGGQILEVPCSRVGHLFRDGNFQIRYTNKDKN 367
            .:.:.:|.|||.||..:.:||.|..|:|.::|.|||.:..:|||||||:||.   |..||  ...
Human   312 VMDKFYFEELGKYDMMMDVWGGENLEISFRVWQCGGSLEIIPCSRVGHVFRK---QHPYT--FPG 371

  Fly   368 SEKKLISRNYRRVAEIWLDEYKDKLFANMPHLTVIPVGNLAEQRDLKNRLHCKPFKWFLDNLATD 432
            ....:.:||.||.||:|:||||:..:|.:|....:|.||:..:.:|:.:|.||||||:|:     
Human   372 GSGTVFARNTRRAAEVWMDEYKNFYYAAVPSARNVPYGNIQSRLELRKKLSCKPFKWYLE----- 431

  Fly   433 FLNLYPIL---DPAEYASGVLQSISSPKLCLDRKDPSHGQPKLAPCSSDHVFPSPEQYWSLTNHR 494
              |:||.|   |..:.|.|.||                                           
Human   432 --NVYPELRVPDHQDIAFGALQ------------------------------------------- 451

  Fly   495 ELRSGFYCLEVRNH---GVNVHIYQCHGQSGNQFWSFDSK 531
               .|..||:...|   || |.:|:||...|||..::.|:
Human   452 ---QGTNCLDTLGHFADGV-VGVYECHNAGGNQVCAWGSQ 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant8NP_648800.1 GT2 128..427 CDD:224137 126/306 (41%)
pp-GalNAc-T 131..430 CDD:133004 126/306 (41%)
Ricin_B_lectin 446..570 CDD:279046 18/89 (20%)
RICIN 448..572 CDD:238092 17/87 (20%)
GALNT2XP_016856452.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.