DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant8 and GALNT1

DIOPT Version :9

Sequence 1:NP_648800.1 Gene:Pgant8 / 39715 FlyBaseID:FBgn0036529 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001371367.1 Gene:GALNT1 / 2589 HGNCID:4123 Length:559 Species:Homo sapiens


Alignment Length:528 Identity:183/528 - (34%)
Similarity:278/528 - (52%) Gaps:63/528 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 GALGRPARGNWTEEQLEAIAKSQRETGYNAWLSKRISPERSLYDMRHRSCKKLKYPMEKLPSVSV 132
            |.:|:|.  ...:|..|.:.:..:...:|...|:.|:..|||.|:|...||...|| :.||:.||
Human    59 GEMGKPV--VIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYP-DNLPTTSV 120

  Fly   133 VITYHNEEASVLLRTLSSLRSRTPIQLLREVILVDDGSTQADEKLNDFIK------IKFLNMVQH 191
            ||.:|||..|.||||:.|:.:|:|..::.|::||||.|.:      ||:|      :|.|.:..|
Human   121 VIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASER------DFLKRPLESYVKKLKVPVH 179

  Fly   192 -RRITTQVGLMHARVVGAELALADVLVFLDSHVEVTKGWLEPLIAPILEDNRTCTTPIIDTIDFD 255
             .|:..:.||:.||:.||.::...|:.|||:|.|.|.||||||:|.|..|.||...||||.|..|
Human   180 VIRMEQRSGLIRARLKGAAVSKGQVITFLDAHCECTVGWLEPLLARIKHDRRTVVCPIIDVISDD 244

  Fly   256 NFAYRRGKP-SRGFFNWEFNYIQLPLLKEEAVAMPA----PHKNPIMNGGLFAIGREWFSELGGY 315
            .|.|..|.. :.|.|||:.|:...|:.:.|......    |.:.|.|.||||:|.|::|.|:|.|
Human   245 TFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRDYFQEIGTY 309

  Fly   316 DKGLKIWGAEQFELSLKLWLCGGQILEVPCSRVGHLFRDGNFQIRYTNKDKNSEKKLISRNYRRV 380
            |.|:.|||.|..|:|.::|.|||.:..|.||.|||:||...   .||......:  :|::|.||:
Human   310 DAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKAT---PYTFPGGTGQ--IINKNNRRL 369

  Fly   381 AEIWLDEYKDKLFANMPHLTVIPVGNLAEQRDLKNRLHCKPFKWFLDNLATDFLNLYPILD-PAE 444
            ||:|:||:|:..:...|.:|.:..|:::.:..|:::|.||||.|:|:       |:||... |..
Human   370 AEVWMDEFKNFFYIISPGVTKVDYGDISSRVGLRHKLQCKPFSWYLE-------NIYPDSQIPRH 427

  Fly   445 YAS-GVLQSISSPKLCLD---RKDPS-------HGQPKLAPCSSDHVFPSPEQYWSLTNHRELRS 498
            |.| |.::::.:.: |||   ||:..       ||.             ...|.:|.|.::|:|:
Human   428 YFSLGEIRNVETNQ-CLDNMARKENEKVGIFNCHGM-------------GGNQVFSYTANKEIRT 478

  Fly   499 GFYCLEVRNHGVNVHIYQCHGQSGNQFWSFDSKTHQVISGQQQNFRHCLEAQPELNAVTSSVCDP 563
            ...||:|......|.:.:||...|||.|.:|...   ::.|..|...||:...|.::...|:.|.
Human   479 DDLCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVK---LTLQHVNSNQCLDKATEEDSQVPSIRDC 540

  Fly   564 K-NHKQQW 570
            . :..|||
Human   541 NGSRSQQW 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant8NP_648800.1 GT2 128..427 CDD:224137 124/310 (40%)
pp-GalNAc-T 131..430 CDD:133004 124/310 (40%)
Ricin_B_lectin 446..570 CDD:279046 33/135 (24%)
RICIN 448..572 CDD:238092 34/134 (25%)
GALNT1NP_001371367.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..65 2/5 (40%)
Catalytic subdomain A 115..225 49/115 (43%)
pp-GalNAc-T 119..419 CDD:133004 125/317 (39%)
Catalytic subdomain B 285..347 31/61 (51%)
Ricin_B_lectin 432..548 CDD:395527 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.