DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant8 and LOC100486078

DIOPT Version :9

Sequence 1:NP_648800.1 Gene:Pgant8 / 39715 FlyBaseID:FBgn0036529 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_002945237.1 Gene:LOC100486078 / 100486078 -ID:- Length:139 Species:Xenopus tropicalis


Alignment Length:137 Identity:31/137 - (22%)
Similarity:57/137 - (41%) Gaps:17/137 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   458 LCLDRKDPSHG-QPKLAPCSSDHVFPS--PEQYWSLTNHRELRSGF------YCLEVRNHGVNVH 513
            :|:..|..:.| :.:|..|:......:  ..|.::|....::|.|.      .|.:..:....|.
 Frog     3 MCVGIKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVT 67

  Fly   514 IYQCHGQSGNQFWSF--DSKTHQVISGQQQNFRHCLEAQPELNAVTSSVCDPKNHKQQWKFGYLN 576
            ::.|||..|||.|.:  |...:...|..      |::.......:..:.|:|.:..|||.|.::|
 Frog    68 LFDCHGMKGNQLWKYRRDKTVYHPTSNS------CMDCNEGEYKIFMNKCNPSSPTQQWTFEHIN 126

  Fly   577 SQRLQHF 583
            |..|:.|
 Frog   127 STILEAF 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant8NP_648800.1 GT2 128..427 CDD:224137
pp-GalNAc-T 131..430 CDD:133004
Ricin_B_lectin 446..570 CDD:279046 24/122 (20%)
RICIN 448..572 CDD:238092 26/124 (21%)
LOC100486078XP_002945237.1 RICIN 2..122 CDD:238092 26/124 (21%)
Ricin_B_lectin 2..120 CDD:279046 24/122 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D144590at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.