DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7579 and GALNT3

DIOPT Version :9

Sequence 1:NP_648799.1 Gene:CG7579 / 39714 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_004473.2 Gene:GALNT3 / 2591 HGNCID:4125 Length:633 Species:Homo sapiens


Alignment Length:536 Identity:156/536 - (29%)
Similarity:249/536 - (46%) Gaps:101/536 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VDAQLQNE----KYQYNAWLSERIPLKRTL-EDYRDPQCLKINYS-SEKTVTVSIVIAIQQEHPH 65
            |:.|.:.|    |:.:||:.|:||.|.|.| .|.|.|:|::..:. .....|.|::|....|...
Human   135 VEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWS 199

  Fly    66 TLLRGIYSVITQTSPYLLKEIVLVHDGHPDLDLIRHIHHKL-------PIVIQLEMESSKGIIHA 123
            ||||.::||:..:...|||||:||.|...|    .::|.||       .||..:.....||:|.|
Human   200 TLLRTVHSVLYSSPAILLKEIILVDDASVD----EYLHDKLDEYVKQFSIVKIVRQRERKGLITA 260

  Fly   124 RLTGAGVATGDILVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQL 188
            ||.||.|||.:.|.||:.|.|...|||.|||..|..|...|..|.:.:|...:|.:.|   |...
Human   261 RLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNK---PSPY 322

  Fly   189 A-------FDWQLDHIFLPLDQHSWNSLP---------KPYP--SSQLEGRVFAIDRKWFWHLGG 235
            .       |||.|        ...|.|||         :.||  :....|.:|:|.:::|.::|.
Human   323 GSNHNRGNFDWSL--------SFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKEYFEYIGS 379

  Fly   236 WDEGLRDYGGDALELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP--SLQVQKNFKR 298
            :||.:..:||:.:|:|.:||||||.:..:|||.||.:::      ..:|:..|  :..:.:|..|
Human   380 YDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFR------SKSPHSFPKGTQVIARNQVR 438

  Fly   299 VVDVWLDEYKLHFYRYNPKLRNLTAE----SLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHA 359
            :.:||:||||..|||.|.....:..:    .|.|..:::.||.||:|.||.:.:.|::....|:.
Human   439 LAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPEVYVPDLNP 503

  Fly   360 GLTNYPIGKIMPFVAPHFCLSI----KGGFPVIR-KCHSTN----FEDWTLTSRCQLKHG---NM 412
            .::.|     :..|....||.:    :||.|:|. .||...    ||   .:::.:::|.   .:
Human   504 VISGY-----IKSVGQPLCLDVGENNQGGKPLIMYTCHGLGGNQYFE---YSAQHEIRHNIQKEL 560

  Fly   413 CLDVDYKNNVRATKCTKK-------------LSKNPWHYNYQHSSFVSNGNKCLQIDVNKVGLIL 464
            ||.. .:..|:...||.|             :.|:...||    .|:   ..||..:.....|: 
Human   561 CLHA-AQGLVQLKACTYKGHKTVVTGEQIWEIQKDQLLYN----PFL---KMCLSANGEHPSLV- 616

  Fly   465 SACDSDVTEQRWMFTK 480
             :|:.....|:|:.::
Human   617 -SCNPSDPLQKWILSQ 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 102/314 (32%)
pp-GalNAc-T 54..349 CDD:133004 108/325 (33%)
RICIN 367..478 CDD:238092 28/135 (21%)
Ricin_B_lectin 373..476 CDD:279046 27/127 (21%)
GALNT3NP_004473.2 Catalytic subdomain A 184..293 46/112 (41%)
pp-GalNAc-T 188..493 CDD:133004 108/325 (33%)
Catalytic subdomain B 356..418 23/61 (38%)
Ricin_B_lectin 506..627 CDD:306998 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.