DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7579 and Galnt3

DIOPT Version :9

Sequence 1:NP_648799.1 Gene:CG7579 / 39714 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_056551.2 Gene:Galnt3 / 14425 MGIID:894695 Length:633 Species:Mus musculus


Alignment Length:517 Identity:152/517 - (29%)
Similarity:241/517 - (46%) Gaps:83/517 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 KYQYNAWLSERIPLKRTL-EDYRDPQCLKINYS-SEKTVTVSIVIAIQQEHPHTLLRGIYSVITQ 77
            |:.:||:.|:||.|.|.| .|.|.|:|::..:. .....|.|::|....|...||||.::||:..
Mouse   147 KHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRCPPLPTTSVIIVFHNEAWSTLLRTVHSVLYS 211

  Fly    78 TSPYLLKEIVLVHDGHPDLDLIRHIHHKL-------PIVIQLEMESSKGIIHARLTGAGVATGDI 135
            :...|||||:||.|...|    .::|.||       .||..:..:..||:|.|||.||.|||.:.
Mouse   212 SPAILLKEIILVDDASVD----DYLHEKLEEYIKQFSIVKIVRQQERKGLITARLLGAAVATAET 272

  Fly   136 LVFLNGHMEVTRGWLPPLLEPILLNNQTVTEPIVDAISRESFAYRKLVEPEQLA-------FDWQ 193
            |.||:.|.|...|||.|||..|..|...|..|.:.:|...:|.:.|   |....       |||.
Mouse   273 LTFLDAHCECFYGWLEPLLARIAENYTAVVSPDIASIDLNTFEFNK---PSPYGSNHNRGNFDWS 334

  Fly   194 LDHIFLPLDQHSWNSLP---------KPYP--SSQLEGRVFAIDRKWFWHLGGWDEGLRDYGGDA 247
            |        ...|.|||         :.||  :....|.:|:|.:|:|.|:|.:||.:..:||:.
Mouse   335 L--------SFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISKKYFEHIGSYDEEMEIWGGEN 391

  Fly   248 LELSLKVWQCGGLILAVPCSRVGIIYKRDELEAQMAPNRNP--SLQVQKNFKRVVDVWLDEYKLH 310
            :|:|.:||||||.:..:|||.||.:::      ..:|:..|  :..:.:|..|:.:||:||||..
Mouse   392 IEMSFRVWQCGGQLEIMPCSVVGHVFR------SKSPHTFPKGTQVIARNQVRLAEVWMDEYKEI 450

  Fly   311 FYRYNPKLRNLTAE----SLDKPRDLRRRLNCKSFEWYRSQVAPQIRNHFLHAGLTNYPIGKIMP 371
            |||.|.....:..:    .|.|..::::||.||:|.||.:.:.|:.....|:..::.|     :.
Mouse   451 FYRRNTDAAKIVKQKSFGDLSKRFEIKKRLQCKNFTWYLNTIYPEAYVPDLNPVISGY-----IK 510

  Fly   372 FVAPHFCLSI----KGGFP-VIRKCHSTN----FEDWTLTSRCQLKHG---NMCLDVDYKNNVRA 424
            .|....||.:    :||.| ::..||...    ||   .:::.:::|.   .:||... :..|:.
Mouse   511 SVGQPLCLDVGENNQGGKPLILYTCHGLGGNQYFE---YSAQREIRHNIQKELCLHAT-QGVVQL 571

  Fly   425 TKCTKK------LSKNPWHYNYQHSSFVSNGNKCLQIDVNKVGLILSACDSDVTEQRWMFTK 480
            ..|..|      ..:..|........:......||..:.....|:  .||:....|:|:|::
Mouse   572 KACVYKGHRTIAPGEQIWEIRKDQLLYNPLFKMCLSSNGEHPNLV--PCDATDLLQKWIFSQ 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539 104/314 (33%)
pp-GalNAc-T 54..349 CDD:133004 110/325 (34%)
RICIN 367..478 CDD:238092 24/128 (19%)
Ricin_B_lectin 373..476 CDD:279046 23/120 (19%)
Galnt3NP_056551.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..145
WcaA 184..>302 CDD:223539 48/121 (40%)
Catalytic subdomain A 184..293 46/112 (41%)
pp-GalNAc-T 188..493 CDD:133004 110/325 (34%)
Catalytic subdomain B 356..418 25/61 (41%)
Ricin_B_lectin 506..627 CDD:279046 24/131 (18%)
RICIN 507..629 CDD:238092 25/132 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.