DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7579 and LOC100486078

DIOPT Version :9

Sequence 1:NP_648799.1 Gene:CG7579 / 39714 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_002945237.1 Gene:LOC100486078 / 100486078 -ID:- Length:139 Species:Xenopus tropicalis


Alignment Length:128 Identity:25/128 - (19%)
Similarity:45/128 - (35%) Gaps:18/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 CLSIK---GGFPV-IRKCH-STNFEDW------TLTSRCQLKHG------NMCLD-VDYKNNVRA 424
            |:.||   .|..: :..|: ..|.:.|      ||..|..::.|      ..|.| |...:.|..
 Frog     4 CVGIKHVTSGTEIRLEACNKGRNSDTWGARQVFTLGWREDIRPGIPQHTMKSCFDAVSQTSPVTL 68

  Fly   425 TKCTKKLSKNPWHYNYQHSSFVSNGNKCLQIDVNKVGLILSACDSDVTEQRWMFTKVQDFKLD 487
            ..|........|.|....:.:....|.|:..:..:..:.::.|:.....|:|.|..:....|:
 Frog    69 FDCHGMKGNQLWKYRRDKTVYHPTSNSCMDCNEGEYKIFMNKCNPSSPTQQWTFEHINSTILE 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7579NP_648799.1 WcaA 52..336 CDD:223539
pp-GalNAc-T 54..349 CDD:133004
RICIN 367..478 CDD:238092 23/117 (20%)
Ricin_B_lectin 373..476 CDD:279046 22/115 (19%)
LOC100486078XP_002945237.1 RICIN 2..122 CDD:238092 23/117 (20%)
Ricin_B_lectin 2..120 CDD:279046 22/115 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D276134at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.