DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7304 and galnt10

DIOPT Version :9

Sequence 1:NP_996098.1 Gene:CG7304 / 39713 FlyBaseID:FBgn0036527 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001070072.1 Gene:galnt10 / 767665 ZFINID:ZDB-GENE-030131-595 Length:261 Species:Danio rerio


Alignment Length:216 Identity:71/216 - (32%)
Similarity:114/216 - (52%) Gaps:17/216 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RDLSSWDGLMGPLSHPGLGENGSASYLSVPSWEIDEYTQGWRYYLYNSWLAERIPLRRSLPDLRD 94
            :|...:..:....:..|.||.|.    ..|..:.:...|.:|...:|.::::||.|.|||||:|.
Zfish    63 KDWHDYAAIRSDAARTGAGEQGR----PYPLTDAERVDQAYRENGFNIFVSDRIALNRSLPDIRH 123

  Fly    95 HRCQKLEYDEDSDEMKPASIIMIFRNEQLVVLLRTLHSLVERTPKYLYIELILVNDHSDTDFWND 159
            ..|:...|..|   :...|:|:.|.||....||||:||:::|:|..|..|:|||:|.||......
Zfish   124 PNCKLKLYTAD---LPNTSVIIPFHNEGWSSLLRTVHSVLDRSPPSLIAEIILVDDFSDKGHLKA 185

  Fly   160 KLSLIFFDNYVHRYIHPKARILHLPEQVGLIKARNLAASEAKAENLVFVDAQVEFTNGWLSPLLD 224
            .|     :.|:.|.  ||.|||...::.|||:.|.|.|:.|:.:.:.|:|:..|....||.||||
Zfish   186 PL-----EQYMVRL--PKVRILRTQKREGLIRTRLLGAAAARGQVITFLDSHCEANVNWLPPLLD 243

  Fly   225 TIAEQSYTLATPILDNLDEQT 245
            .||:.:   .:.:||:.:::|
Zfish   244 RIAQNT---NSSVLDSFNQRT 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7304NP_996098.1 WcaA 108..>231 CDD:223539 47/122 (39%)
pp-GalNAc-T 113..417 CDD:133004 50/133 (38%)
Ricin_B_lectin 433..546 CDD:279046
RICIN 435..548 CDD:238092
galnt10NP_001070072.1 WcaA 134..>260 CDD:223539 50/138 (36%)
Glyco_tranf_GTA_type 139..>253 CDD:299700 47/123 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.