DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7304 and CG7579

DIOPT Version :10

Sequence 1:NP_996098.1 Gene:CG7304 / 39713 FlyBaseID:FBgn0036527 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_648799.1 Gene:CG7579 / 39714 FlyBaseID:FBgn0036528 Length:498 Species:Drosophila melanogaster


Alignment Length:117 Identity:30/117 - (25%)
Similarity:46/117 - (39%) Gaps:30/117 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGEHSPSQPSSHTLPPNQPESP------NHETPNPIPPETNDDDSASSAGVSGSIVSSTTIEAPQ 59
            :||..|...|..||.|..|.:|      ....|.|||     |..|..|.|.   ::.:.:...:
  Fly   244 IGEKIPLYGSGSTLLPPAPPAPLPKPKKKKGAPVPIP-----DPPAPPAPVP---MTLSFVVRSR 300

  Fly    60 VTELGNVSSPPTKIPLRPRKIRKLSPDDDASDGFNPEH-NLSQ-MTTTKPAT 109
            ...||.:        ::|:..:|:..|      .|.|| ||:: :..||..|
  Fly   301 AYVLGKL--------VQPKFYKKIECD------INFEHKNLNKHIVITKNCT 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7304NP_996098.1 pp-GalNAc-T 113..417 CDD:133004
beta-trefoil_Ricin_Pgant8-like 432..549 CDD:467339
CG7579NP_648799.1 pp-GalNAc-T 54..349 CDD:133004 30/117 (26%)
beta-trefoil_Ricin_Pgant8-like 364..479 CDD:467339
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.