DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7304 and Pgant2

DIOPT Version :9

Sequence 1:NP_996098.1 Gene:CG7304 / 39713 FlyBaseID:FBgn0036527 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_608773.2 Gene:Pgant2 / 33556 FlyBaseID:FBgn0031530 Length:633 Species:Drosophila melanogaster


Alignment Length:485 Identity:137/485 - (28%)
Similarity:220/485 - (45%) Gaps:74/485 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YNSWLAERIPLRRSLPDLRDHRCQKLEYDEDSDEMKPASIIMIFRNEQLVVLLRTLHSLVERTPK 139
            :|...::.:|..|.:||.|:..|:..:|.||..|   .|:|:.|.||....||||:.|::.|:|:
  Fly   170 FNQEASDALPSNRDIPDTRNPMCRTKKYREDLPE---TSVIITFHNEARSTLLRTIVSVLNRSPE 231

  Fly   140 YLYIELILVNDHSDTDFWNDKLSLIFFDNYVHRYIHPKARILHLPEQVGLIKARNLAASEAKAEN 204
            :|..|::||:|:||..  .|.|.|...|         |.|::...::.||:::|...|..|.:..
  Fly   232 HLIREIVLVDDYSDHP--EDGLELAKID---------KVRVIRNDKREGLVRSRVKGADAAVSSV 285

  Fly   205 LVFVDAQVEFTNGWLSPLLDTIAEQSYTLATPILDNLDEQTLAY-QRSIERRGMYDWSLTRR--- 265
            |.|:|:.||....||.|||:.:.|....:..|::|.:......| ..|.:.||.:||:|..:   
  Fly   286 LTFLDSHVECNEMWLEPLLERVREDPTRVVCPVIDVISMDNFQYIGASADLRGGFDWNLIFKWEY 350

  Fly   266 EVPLSRARRSHLPWPYEVAAVRT-----SVFAIPAVWFQDISNFDNNLRGFGAAELELSFKVWCT 325
            ..|..||.|.:.|    ..|:||     .:|.|...:|..:..:|..:..:|...||:||:||..
  Fly   351 LSPSERAMRHNDP----TTAIRTPMIAGGLFVIDKAYFNKLGKYDMKMDVWGGENLEISFRVWQC 411

  Fly   326 GGRIVQVPCSRVGHLQPKDEDYLKRYGDLHKMGEQKSRNLKRIIEVWTGDLKSAIYKYQPHLLNI 390
            ||.:..:|||||||:..|...|....|.    |...:||.:|..|||..|.|...|...|...||
  Fly   412 GGSLEIIPCSRVGHVFRKRHPYTFPGGS----GNVFARNTRRAAEVWMDDYKQHYYNAVPLAKNI 472

  Fly   391 SEGDLNEPRKLYKQNECQSFKEFINDITPGLN----HVAALNRTDYAS-----GHV--------- 437
            ..|::::...|.::..|:.||.::.::.|.|.    ......|.|...     ||:         
  Fly   473 PFGNIDDRLALKEKLHCKPFKWYLENVYPDLQAPDPQEVGQFRQDSTECLDTMGHLIDGTVGIFP 537

  Fly   438 -------KTLEFPKK--------CLTI--NAKSQNLFLERCSTNNTLQNWTLT---YVKDLRVAG 482
                   :...|.|:        |||:  .|:...:.|:.|..:.. |.|.:.   .|:..::  
  Fly   538 CHNTGGNQEWAFTKRGEIKHDDLCLTLVTFARGSQVVLKACDDSEN-QRWIMREGGLVRHYKI-- 599

  Fly   483 NICAEVRPNLRLGYS--FCHSLGGRQSWHY 510
            |:|.:.|...:.|.|  .|:|..|.|.|.:
  Fly   600 NVCLDSRDQSQQGVSAQHCNSALGTQRWSF 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7304NP_996098.1 WcaA 108..>231 CDD:223539 42/122 (34%)
pp-GalNAc-T 113..417 CDD:133004 99/312 (32%)
Ricin_B_lectin 433..546 CDD:279046 23/114 (20%)
RICIN 435..548 CDD:238092 23/107 (21%)
Pgant2NP_608773.2 WcaA 200..>432 CDD:223539 81/249 (33%)
pp-GalNAc-T 205..500 CDD:133004 99/313 (32%)
Ricin_B_lectin 511..627 CDD:279046 24/118 (20%)
RICIN 513..629 CDD:238092 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457054
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11675
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.