DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7304 and GALNT8

DIOPT Version :9

Sequence 1:NP_996098.1 Gene:CG7304 / 39713 FlyBaseID:FBgn0036527 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_059113.1 Gene:GALNT8 / 26290 HGNCID:4130 Length:637 Species:Homo sapiens


Alignment Length:503 Identity:132/503 - (26%)
Similarity:222/503 - (44%) Gaps:120/503 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 WRYYLYNSWLAERIPLRRSLPDLRDHRCQKLEYDEDSDEMKPASIIMIFRNEQLVVLLRTLHSLV 134
            :|.:.||::|:.::||.|::||.||:||.:..|   ..::...|:|:||.||.|.::.|.:.|::
Human   144 FRKFGYNAYLSNQLPLNRTIPDTRDYRCLRKTY---PSQLPSLSVILIFVNEALSIIQRAITSII 205

  Fly   135 ERTPKYLYIELILVNDHSDTDFWNDKLSLIFFDNYVHRY--IHP-KARILHLPEQVGLIKARNLA 196
            .|||..|..|:|||:|.|.    |.:|. :..|..:..|  .:| ..:|:..||:.||.:|||..
Human   206 NRTPSRLLKEIILVDDFSS----NGELK-VHLDEKIKLYNQKYPGLLKIIRHPERKGLAQARNTG 265

  Fly   197 ASEAKAENLVFVDAQVEFTNGWLSPLLDTIAEQSYTLATPILDNLDEQTL---AYQRSIERRGMY 258
            ...|.|:.:..:||.:|...||..|:|..|.|....:.:|:.||:...|.   .|:.:::.   :
Human   266 WEAATADVVAILDAHIEVNVGWAEPILARIQEDRTVIVSPVFDNIRFDTFKLDKYELAVDG---F 327

  Fly   259 DWSLTRREVPLSRARRSHLPW--PYEVAA-VRT-SVFAIPAV---WFQDISNFDNNLRGFGAAEL 316
            :|.|..|...|.:|      |  .::|.| |:: |:..|.|.   :..:|.:.|..:..:|...:
Human   328 NWELWCRYDALPQA------WIDLHDVTAPVKSPSIMGILAANRHFLGEIGSLDGGMLIYGGENV 386

  Fly   317 ELSFKVWCTGGRIVQVPCSRVGHLQPKDEDY-------LKRYGDLHKMGEQKSRNLKRIIEVWTG 374
            |||.:||..||::..:||||:.||:...:.|       ||             ||..|:.|:|..
Human   387 ELSLRVWQCGGKVEILPCSRIAHLERHHKPYALDLTAALK-------------RNALRVAEIWMD 438

  Fly   375 DLKSAIY-KYQPHLLN--ISEGDLNEPRKLYKQNECQSFKEFINDITPGLNHVAALNRTDYASGH 436
            :.|..:| .:...|.|  |..||::....|.::.:|::|..::.::.|.|..:    .|....|.
Human   439 EHKHMVYLAWNIPLQNSGIDFGDVSSRMALREKLKCKTFDWYLKNVYPLLKPL----HTIVGYGR 499

  Fly   437 VKTL-----------------------EFPK------------------------KCLTINAKSQ 454
            :|.|                       ||..                        :|||...|::
Human   500 MKNLLDENVCLDQGPVPGNTPIMYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAE 564

  Fly   455 NLFLERCS--TNNTLQ-NWTLTYVKDLRVAGNI-------CAEVRPNL 492
            ...||.||  ..|.|. .|      |.:..|.:       |.|::.:|
Human   565 KPTLEPCSKAAKNRLHIYW------DFKPGGAVINRDTKRCLEMKKDL 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7304NP_996098.1 WcaA 108..>231 CDD:223539 43/125 (34%)
pp-GalNAc-T 113..417 CDD:133004 94/326 (29%)
Ricin_B_lectin 433..546 CDD:279046 21/117 (18%)
RICIN 435..548 CDD:238092 21/115 (18%)
GALNT8NP_059113.1 transmembrane domain 7..29
stem region 30..148 1/3 (33%)
SMC_N <48..>161 CDD:330553 6/16 (38%)
GT1 motif 182..298 42/120 (35%)
pp-GalNAc-T 184..485 CDD:133004 94/327 (29%)
Gal/GalNAc transferase motif 358..397 10/38 (26%)
RICIN 498..624 CDD:238092 21/115 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.