DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7304 and GALNT3

DIOPT Version :9

Sequence 1:NP_996098.1 Gene:CG7304 / 39713 FlyBaseID:FBgn0036527 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_004473.2 Gene:GALNT3 / 2591 HGNCID:4125 Length:633 Species:Homo sapiens


Alignment Length:564 Identity:158/564 - (28%)
Similarity:255/564 - (45%) Gaps:119/564 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 GENGSA---SYLSVPSWEIDEYTQGWRYYLYNSWLAERIPLRRSL-PDLRDHRCQKLEYDEDSDE 108
            |.:|.|   :.|||.  |..|..:|...:.:|::.::||.|.|.| ||.|...|.:.:: :....
Human   122 GASGKAFKTTNLSVE--EQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPECIEQKF-KRCPP 183

  Fly   109 MKPASIIMIFRNEQLVVLLRTLHSLVERTPKYLYIELILVNDHSDTDFWNDKLSLIFFDNYVHRY 173
            :...|:|::|.||....||||:||::..:|..|..|:|||:|.|..::.:|||     |.||.::
Human   184 LPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHDKL-----DEYVKQF 243

  Fly   174 IHPKARILHLPEQVGLIKARNLAASEAKAENLVFVDAQVEFTNGWLSPLLDTIAEQSYTLATPIL 238
              ...:|:...|:.|||.||.|.|:.|.||.|.|:||..|...|||.|||..|||....:.:|.:
Human   244 --SIVKIVRQRERKGLITARLLGATVATAETLTFLDAHCECFYGWLEPLLARIAENYTAVVSPDI 306

  Fly   239 DNLDEQTLAYQR-----SIERRGMYDWSLTRREVPL---SRARRSHLPWPYEVAAVRTSVFAIPA 295
            .::|..|..:.:     |...||.:||||:.....|   .:.||....:|.:.......:|:|..
Human   307 ASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWESLPDHEKQRRKDETYPIKTPTFAGGLFSISK 371

  Fly   296 VWFQDISNFDNNLRGFGAAELELSFKVWCTGGRIVQVPCSRVGHLQPKDEDYLKRYGDLHKMGEQ 360
            .:|:.|.::|..:..:|...:|:||:||..||::..:|||.|||:      :..:.......|.|
Human   372 EYFEYIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHV------FRSKSPHSFPKGTQ 430

  Fly   361 K-SRNLKRIIEVWTGDLKSAIYKYQPHLLNISE----GDLNEPRKLYKQNECQSFKEFINDITPG 420
            . :||..|:.|||..:.|...|:.......|.:    |||::..::..:.:|::|..::|:|.|.
Human   431 VIARNQVRLAEVWMDEYKEIFYRRNTDAAKIVKQKAFGDLSKRFEIKHRLQCKNFTWYLNNIYPE 495

  Fly   421 LNHVAALNRTDYASGHVKTLEFPKKCLTINAKSQNLFLERCSTNNTLQNWTLTYVKDLRVAGNIC 485
            : :|..||  ...||::|::..| .||.:...:|.        ...|..:|              
Human   496 V-YVPDLN--PVISGYIKSVGQP-LCLDVGENNQG--------GKPLIMYT-------------- 534

  Fly   486 AEVRPNLRLGYSFCHSLGGRQSWHYDSVSNQLMSNTK---CLEFT-------------------- 527
                         ||.|||.|.:.| |..:::..|.:   ||...                    
Human   535 -------------CHGLGGNQYFEY-SAQHEIRHNIQKELCLHAAQGLVQLKACTYKGHKTVVTG 585

  Fly   528 --------DEL--NIFLAICDAANGK-------------QRWIL 548
                    |:|  |.||.:|.:|||:             |:|||
Human   586 EQIWEIQKDQLLYNPFLKMCLSANGEHPSLVSCNPSDPLQKWIL 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7304NP_996098.1 WcaA 108..>231 CDD:223539 51/122 (42%)
pp-GalNAc-T 113..417 CDD:133004 101/316 (32%)
Ricin_B_lectin 433..546 CDD:279046 30/158 (19%)
RICIN 435..548 CDD:238092 30/158 (19%)
GALNT3NP_004473.2 Catalytic subdomain A 184..293 48/115 (42%)
pp-GalNAc-T 188..493 CDD:133004 101/317 (32%)
Catalytic subdomain B 356..418 20/67 (30%)
Ricin_B_lectin 506..627 CDD:306998 30/157 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.