DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7304 and GALNTL5

DIOPT Version :9

Sequence 1:NP_996098.1 Gene:CG7304 / 39713 FlyBaseID:FBgn0036527 Length:563 Species:Drosophila melanogaster
Sequence 2:XP_016867282.1 Gene:GALNTL5 / 168391 HGNCID:21725 Length:496 Species:Homo sapiens


Alignment Length:454 Identity:123/454 - (27%)
Similarity:207/454 - (45%) Gaps:74/454 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VWIFIVLLLLHRD-LSSWD-GLMGPLS--HPGLGENGSASYLS--VPSWEI-------------- 63
            :|..::.:.||.: :|||. ....|||  .||...:....|.|  :|...:              
Human    71 IWTALLFIYLHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIVKRTDEDKAKSML 135

  Fly    64 --------DEYTQGWRYYLYNSWLAERIPLRRSLPDLRDHRCQKLEYDEDSDEMKPASIIMIFRN 120
                    .|..:....|.:|..::..:.:.|.:||.|...|.:..|..   .:..|||::.|.|
Human   136 GTDFNHTNPELHKELLKYGFNVIISRSLGIEREVPDTRSKMCLQKHYPA---RLPTASIVICFYN 197

  Fly   121 EQLVVLLRTLHSLVERTPKYLYIELILVNDHSDTDFWNDKLSLIFFDNYVHRYIHPKARILHLPE 185
            |:...|.:|:.|:...||.|...|:|||:|.|..|...:||      :|.......|.:|:...:
Human   198 EECNALFQTMSSVTNLTPHYFLEEIILVDDMSKVDDLKEKL------DYHLETFRGKVKIIRNKK 256

  Fly   186 QVGLIKARNLAASEAKAENLVFVDAQVEFTNGWLSPLLDTIAEQSYTLATPILDNLDEQTLAYQR 250
            :.|||:||.:.||.|..:.|||:|:..|....||.|||..||:....:..|::|.:|::||.|:.
Human   257 REGLIRARLIGASHASGDVLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKP 321

  Fly   251 SIERRGMYDWSLTRREVPLSRARRSHLPW----------------PYEVAAVRTSVFAIPAVWFQ 299
            |...||.:||:|             ...|                |....|:...:|||...:|.
Human   322 SPLVRGTFDWNL-------------QFKWDNVFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFN 373

  Fly   300 DISNFDNNLRGFGAAELELSFKVWCTGGRIVQVPCSRVGHLQPKDEDYLKRYGDLHKMGEQKSRN 364
            :|..:|.::..:|...||||.::|..||::..:|||||||:..      |:.|....:....:.|
Human   374 EIGQYDKDMDFWGRENLELSLRIWMCGGQLFIIPCSRVGHISK------KQTGKPSTIISAMTHN 432

  Fly   365 LKRIIEVWTGDLKSAIYKYQPHLLNISEGDLNEPRKLYKQNECQSFKEFINDITPGLNHVAALN 428
            ..|::.||..:.|...:..:|.|..::.|::.|..:|.|:..|:||:.:::::.|.|.  |::|
Human   433 YLRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVELRKRLGCKSFQWYLDNVFPELE--ASVN 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7304NP_996098.1 WcaA 108..>231 CDD:223539 44/122 (36%)
pp-GalNAc-T 113..417 CDD:133004 95/319 (30%)
Ricin_B_lectin 433..546 CDD:279046
RICIN 435..548 CDD:238092
GALNTL5XP_016867282.1 GT2 187..437 CDD:224137 84/274 (31%)
pp-GalNAc-T 190..486 CDD:133004 95/320 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152525
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.