DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7304 and GALNT13

DIOPT Version :9

Sequence 1:NP_996098.1 Gene:CG7304 / 39713 FlyBaseID:FBgn0036527 Length:563 Species:Drosophila melanogaster
Sequence 2:NP_001363332.1 Gene:GALNT13 / 114805 HGNCID:23242 Length:571 Species:Homo sapiens


Alignment Length:565 Identity:159/565 - (28%)
Similarity:278/565 - (49%) Gaps:60/565 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VWIFI-VLLLLH----------RDLSSWDGLMGPLS--HPGLGENGSASYLSVPSWEIDEYTQGW 70
            :|:.: |.|||:          ::.|....|...:|  ..|.||.|.|  :.:|..:.::..:.:
Human    16 MWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKA--VLIPKDDQEKMKELF 78

  Fly    71 RYYLYNSWLAERIPLRRSLPDLRDHRCQKLEYDEDSDEMKPASIIMIFRNEQLVVLLRTLHSLVE 135
            :...:|...::.|.|.|||||:|...|:...|   .||:...|::::|.||....||||::|::.
Human    79 KINQFNLMASDLIALNRSLPDVRLEGCKTKVY---PDELPNTSVVIVFHNEAWSTLLRTVYSVIN 140

  Fly   136 RTPKYLYIELILVNDHSDTDFWNDKLSLIFFDNYVHRYIHPKARILHLPEQVGLIKARNLAASEA 200
            |:|.||..|:|||:|.|:.||.  ||:|   :||| :.:....:|:.:.|:.|||:||...|:.:
Human   141 RSPHYLLSEVILVDDASERDFL--KLTL---ENYV-KNLEVPVKIIRMEERSGLIRARLRGAAAS 199

  Fly   201 KAENLVFVDAQVEFTNGWLSPLLDTIAEQSYTLATPILDNLDEQTLAYQRSIERR-GMYDWSLTR 264
            |.:.:.|:||..|.|.|||.|||..|.|...|:..||:|.:.:.|..|....:.. |.::|.|..
Human   200 KGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNF 264

  Fly   265 REVPLSR----ARRSHLPWPYEVAAVRTSVFAIPAVWFQDISNFDNNLRGFGAAELELSFKVWCT 325
            |..|:.:    .|:.....|.....:...:|:|...:|::|..:|..:..:|...||:||::|..
Human   265 RWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQC 329

  Fly   326 GGRIVQVPCSRVGHLQPKDEDYLKRYGDLHKMGEQKSRNLKRIIEVWTGDLKSAIYKYQPHLLNI 390
            ||.:..|.||.|||:..|...|....|..|.:    ::|.:|:.|||..:.|...|...|.::.:
Human   330 GGSLEIVTCSHVGHVFRKATPYTFPGGTGHVI----NKNNRRLAEVWMDEFKDFFYIISPGVVKV 390

  Fly   391 SEGDLNEPRKLYKQNECQSFKEFINDITPGLNHVAALNRTDYASGHVKTLEFPKKCLTINAKSQN 455
            ..||::..:.|.:..:|:.|..::.:|.|.    :.:.|..|:.|.::.:| ..:||....:.:|
Human   391 DYGDVSVRKTLRENLKCKPFSWYLENIYPD----SQIPRRYYSLGEIRNVE-TNQCLDNMGRKEN 450

  Fly   456 --LFLERCSTNNTLQNWTLTYVKDLRVAGNICAEVR----PNLRLGYSFCHSLGGRQSWHYDSVS 514
              :.:..|......|.::.|..|::| ..::|.:|.    |.:.|.   ||.:.|.|.|.||:.:
Human   451 EKVGIFNCHGMGGNQVFSYTADKEIR-TDDLCLDVSRLNGPVIMLK---CHHMRGNQLWEYDAET 511

  Fly   515 NQLMS--NTKCLEFTDELNIFLAICDAANGKQRWILDNINLSVMQ 557
            :.|:.  ...|          |::...|:|.|...::..|.|.:|
Human   512 HTLLHIITQSC----------LSVNKVADGSQHPTVETCNDSTLQ 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7304NP_996098.1 WcaA 108..>231 CDD:223539 50/122 (41%)
pp-GalNAc-T 113..417 CDD:133004 98/308 (32%)
Ricin_B_lectin 433..546 CDD:279046 27/120 (23%)
RICIN 435..548 CDD:238092 27/120 (23%)
GALNT13NP_001363332.1 pp-GalNAc-T 118..418 CDD:133004 98/309 (32%)
Ricin_B_lectin 431..548 CDD:395527 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152539
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.