DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eig71Ei and Eig71Ec

DIOPT Version :10

Sequence 1:NP_648795.2 Gene:Eig71Ei / 39710 FlyBaseID:FBgn0014849 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_524090.2 Gene:Eig71Ec / 39703 FlyBaseID:FBgn0004590 Length:173 Species:Drosophila melanogaster


Alignment Length:97 Identity:40/97 - (41%)
Similarity:53/97 - (54%) Gaps:7/97 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLLLPLAIVCLFMAHIQANPEEANRRHKICIRTYDKCIENEARLGKQDDTSKFFNDYCRRSDS 65
            |.|:.|..||:||.:| :||.    .|..:||.:..:.|..||.|||.|:|.|..||::|||...
  Fly     1 MSKITLIFAILCLCVA-VQAQ----TREQEICRQENETCRRNERRLGVQNDVSTTFNNHCRRQSG 60

  Fly    66 --GWSDVSRCDLLRIACLSTVRDCETPTCKNV 95
              .|.:||||:|....|..|:..|....||||
  Fly    61 IRNWRNVSRCELSLATCRLTLERCAVINCKNV 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eig71EiNP_648795.2 L71 31..97 CDD:426778 29/67 (43%)
Eig71EcNP_524090.2 L71 26..94 CDD:426778 29/67 (43%)

Return to query results.
Submit another query.