DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eig71Eh and Eig71Ef

DIOPT Version :9

Sequence 1:NP_648794.3 Gene:Eig71Eh / 39709 FlyBaseID:FBgn0014848 Length:101 Species:Drosophila melanogaster
Sequence 2:NP_524093.2 Gene:Eig71Ef / 39707 FlyBaseID:FBgn0004593 Length:98 Species:Drosophila melanogaster


Alignment Length:98 Identity:53/98 - (54%)
Similarity:79/98 - (80%) Gaps:2/98 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLT--VCFLVILGCVIVHGQSPDCKEIKDICSKCIQRLNDPYNKVDFINKGCRNRVRGSYVWKD 63
            |:||  :|.::.||||:::||||||::::|.|:.||:|||:|.|.|:|:|:|||.:|||.|:||:
  Fly     1 MQLTSIICVILFLGCVLINGQSPDCRKLRDTCNPCIRRLNNPINNVEFMNEGCREKVRGRYIWKN 65

  Fly    64 QNLCELQAIACSAPNRAMNCVVIADVAKMRRVT 96
            |..|:||.|||||..|.::|:|||::|.|.|.|
  Fly    66 QTRCDLQVIACSAHKRKLDCLVIAELAGMPRRT 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eig71EhNP_648794.3 L71 22..86 CDD:280587 34/63 (54%)
Eig71EfNP_524093.2 L71 24..88 CDD:280587 34/63 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0012683
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.